KEGG   Mus musculus (mouse): 56207
Entry
56207             CDS       T01002                                 

Gene name
Uchl5, 5830413B11Rik, Uch37
Definition
(RefSeq) ubiquitin carboxyl-terminal esterase L5
  KO
K05610  ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    56207 (Uchl5)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    56207 (Uchl5)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     56207 (Uchl5)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   56207 (Uchl5)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    56207 (Uchl5)
SSDB
Motif
Pfam: Peptidase_C12 UCH_C PNPase DUF2785
Other DBs
NCBI-GeneID: 56207
NCBI-ProteinID: NP_062508
MGI: 1914848
Ensembl: ENSMUSG00000018189
Vega: OTTMUSG00000049324
UniProt: Q9WUP7
Structure
PDB: 
4WLR 4WLQ

Position
1 F; 1 62.54 cM
AA seq 329 aa
MSSNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPESFEKLKPVHGLIFLFKWQP
GEEPAGSVVQDSRLETIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQS
FDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTPAKEEDAFHFVSYVPVNGRLYELDG
LREGPIDLGACNQDDWITAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQR
QLAEEEPMDTDQGSTVLSAIQSEVARNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELL
KTLAEHQQLIPLVEKAKEKQNAKKAQETK
NT seq 990 nt   +upstreamnt  +downstreamnt
atgtcgagcaatgccggggagtggtgtctcatggaaagcgaccccggggtcttcaccgag
ctcattaaaggattcggttgccgaggggcccaagtagaagaaatatggagcttagaacct
gagagttttgaaaagctaaagccagttcatgggttaatttttcttttcaagtggcagcca
ggagaagaacctgctggctctgtggtccaggactccagacttgaaacaatattttttgcc
aagcaggtaattaataatgcttgtgccactcaggctatcgtaagtgtactactgaactgt
acgcatcaagatgtgcatttaggagagacattatcagaatttaaagaattttctcaaagt
tttgatgcagctatgaaggggctggcattgagtaactcagatgtgattcgacaagtgcac
aacagttttgccaggcagcagatgtttgaatttgatacaaagacaccagccaaagaggag
gatgcttttcactttgtcagttacgttccagtcaatgggaggctgtatgaactagacggg
ttaagagagggcccaattgatttaggtgcatgcaatcaagatgactggattactgcagtg
aggccagtaatagagaaaaggattcaaaagtatagtgaaggagaaattcgatttaattta
atggccattgtatctgacagaaaaatgatatatgaacagaagatagcagagttacaaaga
caacttgcagaggaggaacccatggatacagatcaaggtagtaccgtgttaagtgctatt
cagtcagaagttgccagaaaccagatgcttattgaagaagaggtacaaaagttaaagaga
tataagattgaaaatatcagaaggaagcataattacttgcctttcattatggaattgtta
aagaccttagctgagcaccagcagttaattccacttgtggaaaaggcaaaagaaaaacag
aatgcaaagaaagctcaggaaactaagtga

DBGET integrated database retrieval system