KEGG   Mus musculus (mouse): 56208
Entry
56208             CDS       T01002                                 

Gene name
Becn1, Atg, Atg6
Definition
(RefSeq) beclin 1, autophagy related
  KO
K08334  beclin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04136  Autophagy - other
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu04215  Apoptosis - multiple species
mmu04371  Apelin signaling pathway
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    56208 (Becn1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    56208 (Becn1)
   04136 Autophagy - other
    56208 (Becn1)
   04137 Mitophagy - animal
    56208 (Becn1)
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    56208 (Becn1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    56208 (Becn1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    56208 (Becn1)
   05014 Amyotrophic lateral sclerosis
    56208 (Becn1)
   05016 Huntington disease
    56208 (Becn1)
   05017 Spinocerebellar ataxia
    56208 (Becn1)
   05022 Pathways of neurodegeneration - multiple diseases
    56208 (Becn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    56208 (Becn1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    56208 (Becn1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    56208 (Becn1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    56208 (Becn1)
SSDB
Motif
Pfam: APG6 APG6_N BH3 MT HAUS-augmin3 ERM Exonuc_VII_L V_ATPase_I Suppressor_APC
Other DBs
NCBI-GeneID: 56208
NCBI-ProteinID: NP_062530
MGI: 1891828
Ensembl: ENSMUSG00000035086
Vega: OTTMUSG00000002791
UniProt: O88597
Structure
PDB: 
5YR0

Position
11; 11 D
AA seq 448 aa
MEGSKASSSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEE
ANSGEEPFIETRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDL
FDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQR
ELKELALEEERLIQELEDVEKNRKVVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLE
LDDELKSVENQVRYAQIQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNE
INAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWD
NKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSE
EQWTKALKFMLTNLKWGLAWVSSQFYNK
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggaggggtctaaggcgtccagcagcaccatgcaggtgagcttcgtgtgccagcgctgt
agccagcctctgaaactggacacgagcttcaagatcctggaccgggtcaccatccaggaa
ctcacagctccattacttaccacagcccaggcgaaaccaggagagacccaggaggaagag
gctaactcaggagaggagccatttattgaaactcgccaggatggtgtctctcgaagattc
atccccccagccaggatgatgtctacagaaagtgctaatagcttcactctgatcggggag
gcatctgatggtggcaccatggagaacctcagccggagactcaaggtcactggagacctg
tttgacatcatgtcgggccagaccgatgtggatcacccgctgtgtgaggaatgcacagac
actcttttagaccagctggacactcagctcaatgtcactgagaatgaatgtcagaactac
aaacgctgtttggagatcctagagcagatgaatgaggatgacagtgagcagctgcagagg
gagctgaaggagctggccttggaggaggagaggctgatccaggagctggaagatgtggaa
aagaaccgcaaggtggtggcagagaacctggagaaggtccaggctgaggcggagagattg
gaccaggaggaagctcagtaccagcgggagtatagtgagtttaaaaggcagcagctggag
ttggatgacgaactcaagagtgtggagaaccaggtgcgctacgcccagatccagctggac
aagctcaagaaaaccaatgtcttcaatgccaccttccacatctggcacagcggacagttt
ggcacaatcaataatttcagactgggtcgcttgcccagtgttcctgtggagtggaatgaa
atcaatgctgcctggggccagacagtgctgctgctccatgctttggccaataagatgggt
ctgaagtttcagaggtaccgacttgttccctatggaaatcattcctatctggagtctctg
acagacaaatctaaggagttgccgttatactgttctgggggtttgcggtttttctgggac
aacaagtttgaccatgcaatggtagcttttctggactgtgtgcagcagttcaaagaagag
gtggaaaaaggagagactcgattttgtcttccgtacaggatggacgtggagaaaggcaag
attgaagacactggaggcagtggcggctcctattccatcaaaacccagtttaactcggag
gagcagtggacaaaagcgctcaagttcatgctgaccaatctcaagtggggtcttgcctgg
gtgtcctcacagttctataacaagtga

DBGET integrated database retrieval system