KEGG   Mus musculus (mouse): 56209
Entry
56209             CDS       T01002                                 

Gene name
Gde1, 1200003M13Rik, Mir16, RGS16
Definition
(RefSeq) glycerophosphodiester phosphodiesterase 1
  KO
K19179  glycerophosphoinositol glycerophosphodiesterase [EC:3.1.4.44]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    56209 (Gde1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.44  glycerophosphoinositol glycerophosphodiesterase
     56209 (Gde1)
SSDB
Motif
Pfam: GDPD
Other DBs
NCBI-GeneID: 56209
NCBI-ProteinID: NP_062526
MGI: 1891827
Ensembl: ENSMUSG00000033917
Vega: OTTMUSG00000023306
UniProt: Q9JL56
Position
7; 7 F2
AA seq 331 aa
MWLWEDQGGLLGPFSFVLVLLLVVTRSPFNACVLTGSLYILLRFFSFEPVPSRRALQVLK
PRDRVSAIAHRGGSHDAPENTLAAIRQAAKNGATGVELDIEFTSDGVPVLMHDNTVDRTT
DGSGRLCDLTFEQVRKLNPAANHRLRNEFPDERIPTLKEAVTECLRHNLTIFFDVKGHAD
MASAALKNIYTEFPQLYNNSMVCSFLPEVIYKMRQTDQKVITALTHRPWSLSHTGDGKPR
YSVFWKQSVFVVLDILLDWSMHNVLWYLCGISAFLMQKDFVSPDYLKKWSAKGIQVVSWT
VNTFDEKNYYESHLGSSYITDSMLEDCAPHF
NT seq 996 nt   +upstreamnt  +downstreamnt
atgtggctgtgggaggaccagggcggcctcctgggccccttctccttcgtgctggtgctg
ctgctggtggtgacacgcagccccttcaacgcctgcgtgctcaccggcagcctctacatc
ctgctgcggttcttcagcttcgagccggtgccgtcccgccgggccctgcaggtgctcaag
ccccgtgaccgcgtgtccgccatcgcccatcgcggcggcagccacgacgcgcccgagaac
acgctggcggccatccggcaggcagctaagaatggagcaacaggtgtggagctggacatc
gagtttacttctgatggagttcctgtcttgatgcacgataacacagtagataggacaaca
gacgggtctggccgactatgtgatctgacatttgaacaagttaggaaacttaaccctgca
gcaaatcacagactcagaaacgagttccctgatgaaaggatccctaccctgaaggaagct
gtcacagagtgcctccgccataacctcaccatcttctttgatgtcaaaggccatgcagat
atggcttctgctgctctaaagaatatatacacggaatttccacagctgtacaataacagt
atggtctgctcattcttgccggaagtcatctataaaatgagacaaacggatcagaaggta
atcacagccctaactcacaggccttggagcctgagccacactggagatgggaagcctcgc
tacagcgtcttttggaagcagtctgtgtttgtggtgttggacatcttgctggactggagc
atgcacaatgtcttgtggtacctgtgtgggatttcagccttcctcatgcagaaggatttt
gtctccccggactatttgaagaagtggtcagctaaaggaatccaggttgtgagttggact
gtcaatacctttgatgaaaagaattactacgagtcccaccttgggtccagctacatcact
gacagcatgctagaagactgtgcacctcacttctag

DBGET integrated database retrieval system