KEGG   Mus musculus (house mouse): 56217
Entry
56217             CDS       T01002                                 
Symbol
Pals1, 3830420B02Rik, Mpp5
Name
(RefSeq) protein associated with LIN7 1, MAGUK family member
  KO
K06091  MAGUK p55 subfamily member 5
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04390  Hippo signaling pathway
mmu04530  Tight junction
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    56217 (Pals1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    56217 (Pals1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    56217 (Pals1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    56217 (Pals1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 PDZ domain-containing proteins
  MAGUK family proteins
   56217 (Pals1)
SSDB
Motif
Pfam: Guanylate_kin L27_N PDZ SH3_2 PDZ_6 L27 SH3_1 PDZ_2 SH3_9 Peptidase_M50
Other DBs
NCBI-GeneID: 56217
NCBI-ProteinID: NP_062525
MGI: 1927339
Ensembl: ENSMUSG00000021112
UniProt: Q9JLB2 B2RRY4
Structure
Position
12:78795606..78887488
AA seq 675 aa
MTTSYMNGHVTEESDSGIKNLDLASPEEYPKHREMAVDCPGDLGTRMMPVRRSAQLERIR
QQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPIFDTEEGIVLESPHYAVN
ILDVEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNRDFQNAFKIHNAVTVHMSKASPPF
PLIANVQDLVQEVQTVLKPVHQKEGQELTALLNAPHIQALLLAHDKVAEQEMQLEPITDE
RVYESIGHYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDE
VLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSD
DPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMK
QTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKR
PIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRNRRDHEVAGRDYHFVSRQAFEADI
AAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPP
SQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLIN
KLDTEPQWVPSTWLR
NT seq 2028 nt   +upstreamnt  +downstreamnt
atgacaacatcatatatgaatgggcatgtaacagaggaatcagacagcggaataaaaaat
cttgatcttgcatcaccagaggaatatccgaagcaccgagagatggctgttgactgccct
ggagatttgggcaccagaatgatgccagtgcgaagaagtgcacagttagagcggattcga
caacaacaggaggatatgagacgtaggcgcgaagaggaagggaaaaagcaagaacttgac
ctaaattcttccatgagacttaagaaactagctcaaattcctccaaagactggaatagat
aaccctatatttgacacggaagaaggaattgttttagaaagtcctcactatgctgtgaac
atattagacgttgaagacttgttctcttcacttaaacacatccaacacactttggttgat
tctcagagccaggaggatatctcactgcttttacagcttgtacaaaacagagattttcag
aatgcattcaagatacacaatgctgtcacagtacacatgagcaaggccagccctccgttt
cctcttatcgccaatgtacaagaccttgtacaagaggtacaaactgtcttaaagccagtc
catcagaaggaaggacaagaactaactgccttgttgaatgctccacatattcaggcactt
ttactggcccatgataaggttgctgagcaggaaatgcagctagagcccattacagatgag
agagtttatgaaagtatcggccattacgggggagaaactgtaaaaatagttcgtatagaa
aaggctcgggatattccattgggtgccacagttcgtaatgaaatggattctgtcatcata
agccggatagtgaaaggaggcgccgcagagaagagtggcctcctgcacgaaggagacgaa
gttctggagatcaacggcattgaaatccggggcaaggatgtcaatgaggtttttgacttg
ttgtctgatatgcatggtactttgacatttgttctgattcctagtcaacagatcaagccc
cctcctgccaaagaaactgtaatccatgtgaaagctcattttgactatgacccctcagat
gacccttatgttccatgtcgagagttagggctgtcttttcaaaaaggagatatacttcat
gtgatcagtcaagaagatccaaattggtggcaggcctatagagagggagacgaagataat
cagcctctagctggacttgttccaggcaaaagctttcagcagcaaagggaagccatgaag
caaactatagaagaagataaggagccagagaaatcaggaaaactgtggtgtgcaaagaag
aataaaaagaagaggaaaaaggttttatataatgccaataaaaatgatgattatgacaat
gaagagatcttaacgtatgaggaaatgtcactttatcaccagccagcaaataggaaaaga
cctatcatcttgatcggtccacagaactgtggccagaatgaactgcgccagagactaatg
aataaggaaaaagaccgctttgcatctgccgttcctcatacaactcggaataggcgagac
catgaagtagctgggagagattaccactttgtttctcggcaagcatttgaagcagacata
gcagctggcaagttcattgaacatggtgaatttgagaaaaatctgtatggaaccagcata
gactctgtacgacaagtaatcaactctggcaagatatgtctcttaagtcttcgcacacag
tccttgaagaccctccggaattcagatttgaaaccatatatcatcttcattgcaccacct
tcacaagagagacttcgggcgttgttagccaaggaaggcaagaacccaaagcctgaagaa
ttaagggagatcattgagaagacgagagagatggagcagaacaacggacactacttcgac
actgcaattgtgaattcagatcttgataaagcctatcaggaattgcttaggctcattaac
aaactggatactgaacctcagtgggtgccatccacctggctaaggtga

DBGET integrated database retrieval system