KEGG   Mus musculus (mouse): 56249
Entry
56249             CDS       T01002                                 

Gene name
Actr8, 5730542K05Rik, A, ARP8
Definition
(RefSeq) ARP8 actin-related protein 8
  KO
K11673  actin-related protein 8
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    56249 (Actr8)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromatin remodeling factors
   INO80 complex
    56249 (Actr8)
   INO80 complex (yeast)
    56249 (Actr8)
SSDB
Motif
Pfam: Actin Actin_micro
Other DBs
NCBI-GeneID: 56249
NCBI-ProteinID: NP_081769
MGI: 1860775
Ensembl: ENSMUSG00000015971
UniProt: Q8R2S9
Position
14; 14 A3
AA seq 624 aa
MTQAEKGDAENGKEKGGEKEKEQRGVKRPIVPALVPESLQEQIQSNFIVVIHPGSTTLRL
GRATDTLPVSVPHVIARRHKQQGQPLYKDNWLLREGLNKPESNEQRQNGLKMVDQAIWSK
KMSNGTRRIPVSPEQTRSYNKQMRPAILDHCSGNKWTNTSQQPEYLVGEEALYVNPLDCY
NIHWPIRRGQLNIHPGPGGSLTAVLADIEVIWSHAIQKYLEIPLKDLKYYRCILLIPDIY
NKQHVKELVHMILMKMGFAGIVVHQESVCATFGSGLSSTCVVDVGDQKTSVCCVEDGVSH
RNTRLCLAYGGSDVSRCFYWLMQRAGFPYRECQLTNKMDCLLLQHLKETFCHLDQDISGL
QDHEFQIRHPDSPALLYQFRLGDEKLQAPMALFYPATFGIVGQKMTTLQHRSQGDPEDPH
DEHYLLATQSKQEQSAKATADRKSASKPIGFEGDLRGQSSDLPERLHSQEVDLASSQGDC
LMAGNESEEALTALMSRKTAISLFEGKALGLDKAILHSVDCCSSDDTKKKMYSSILVVGG
GLMFHKAQEFLQHRILNKMPPSFRRIIENVDVITRPKDMDPRLIAWKGGAVLACLDTTQE
LWIYQREWQRFGVRMLRERAAFVW
NT seq 1875 nt   +upstreamnt  +downstreamnt
atgacccaagccgagaagggggacgcggagaacgggaaggagaagggcggggagaaggag
aaggagcagcgcggcgtgaagcggcccatcgtacccgcgttggtccccgagtcgctgcag
gagcaaatccagagcaacttcattgttgtcatacacccaggttcaacaactctaagactt
ggccgagccacagatacacttccggtcagtgttcctcacgtcattgcacgaagacacaaa
caacaagggcagcccctgtacaaggacaactggctcctaagggaaggactaaataaacct
gaaagtaatgaacaaagacaaaatggccttaaaatggtggaccaggcaatatggtctaaa
aagatgtcaaacggtacaaggcggatccctgtgtcaccagaacagacacgctcctacaac
aagcagatgcgacctgccattctagatcactgttctggaaacaaatggacaaacacatct
cagcagcctgagtatttggtaggagaagaggccttgtatgttaaccccctggactgttac
aacattcactggcctatcagaaggggtcagctgaacatccacccaggccccggaggctcc
ctcacagctgttctggcagacattgaagtgatctggtctcatgcaatacaaaagtatttg
gaaatcccactgaaagatttaaagtattacaggtgcatcttgttaattccagatatctat
aacaagcagcatgtgaaagagctggtccatatgatactgatgaagatgggcttcgcaggg
attgtggtccatcaggagtctgtgtgcgctacgtttgggagcggcttgagcagcacctgt
gttgtagatgttggggaccagaaaacaagtgtgtgctgtgtagaggatggggtgtctcat
cggaacacacggctttgtctggcctatgggggctctgacgtgtcgaggtgtttttactgg
ctcatgcagcgagcgggattcccttacagagagtgtcagctgacaaataaaatggattgc
ctcctcttgcagcaccttaaagaaaccttttgtcatttagatcaggatatctccggactt
caggaccatgagtttcagattcggcatccggattcccctgccctgctttaccagtttcga
ttaggagatgaaaagctccaggctccaatggcgcttttttacccagcaacctttgggatc
gtgggacagaagatgaccactctgcagcacaggtcccagggagaccctgaggatccccat
gatgagcactacctgctggccacccagagcaagcaagaacagtctgcaaaagccactgct
gaccgcaagtctgcatccaaacccattggatttgaaggggatctgcgtggccagtcctct
gatcttccagaaagactccattcccaggaggtggacctggcttcttctcagggagactgt
ttgatggcgggcaatgagtccgaggaagccctcactgcactgatgtccaggaaaactgca
atctcgctgtttgaggggaaagccttgggccttgataaggccatcctgcacagcgtagac
tgttgctcatctgatgataccaaaaagaagatgtatagctctatcctggttgtgggaggc
ggtttgatgtttcataaggctcaagagtttctccagcacagaattctcaacaaaatgccg
ccttcattcaggcgaattattgaaaacgtggatgtgatcacaaggcccaaggacatggac
ccccggctgatcgcatggaaaggaggtgcagtactggcgtgtttggacaccactcaggaa
ctgtggatttatcagcgagagtggcaacgctttggtgtccgaatgttacgggaacgagct
gcctttgtgtggtga

DBGET integrated database retrieval system