KEGG   Mus musculus (mouse): 56273
Entry
56273             CDS       T01002                                 

Gene name
Pex14, Pex1, Pex14p, R75137
Definition
(RefSeq) peroxisomal biogenesis factor 14
  KO
K13343  peroxin-14
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    56273 (Pex14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    56273 (Pex14)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Pexophagy
   Selective cargos
    56273 (Pex14)
SSDB
Motif
Pfam: Pex14_N DUF948 Bacillus_HBL Cob_adeno_trans Telomere_reg-2 TMPIT Fib_alpha DUF1664
Other DBs
NCBI-GeneID: 56273
NCBI-ProteinID: NP_062755
MGI: 1927868
Ensembl: ENSMUSG00000028975
Vega: OTTMUSG00000010943
UniProt: Q9R0A0
Position
4; 4 E2
AA seq 376 aa
MASSEQAEQPNQPSSPPGSENVVPREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTD
EEIDLAFQQSGTAADEPSPLGPATPVVPVQPPHLTPQPYSPRGSRWRDYGALAIIMAGIA
FGFHQLYKRYLLPLILGGREDRKQLERMAASLSELSGTVAQTVTQVQTTLASVQELLRQQ
QQKVQELAHELATAKATTSTNWILESQNINELKSEINSLKGLLLNRRQFPPSPSAPKIPS
WQIPVKSSSPSSPAAVNHHSSSDISPVSNESTSSSPGKDSHSPEGSTATYHLLGPQEEGE
GVLDVKGQVRMEVQGEEEKREDKEDEDDEDDDVSHVDEEDVLGVQREDRRGGDGQINEQV
EKLRRPEGASNETERD
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggcgtcgtcggagcaggcagagcagccgaaccagccaagctctcctccaggaagtgaa
aatgtggtgccccgagagccactgattgccacagcagtgaagttcctacagaattctcgg
gtccggcagagcccacttgcgaccaggagagcatttcttaagaagaaaggactgacagac
gaagagattgacctggctttccagcagtcgggcacagctgccgacgagccttcacccctg
ggcccagctaccccagtggttcctgtccagccccctcacctcactccgcagccatacagc
cccagaggctcccgatggcgagattatggtgccttggctatcatcatggcaggaattgca
tttggctttcaccaactctacaagaggtacctgctgcccctcatcctgggaggccgagag
gacagaaagcagctggagaggatggcagcgagtctctcggaactgagtggcaccgtggcc
cagacagtgactcaggtgcagacaacactggcctctgtccaagagctactgagacagcag
cagcagaaggtccaggagctagctcacgagctggccactgccaaggccaccacatcaacc
aactggatcctggagtcccagaatattaatgagctcaagtcggaaatcaactccttgaaa
ggacttcttttgaatcggagacagttccctccttccccgtcggccccgaagatcccctcc
tggcagatcccagtgaagtcttcatcaccctccagccctgcggctgtcaaccaccacagc
agcagtgacatctcccctgtcagcaacgagtctacgtcatcctctcctgggaaggacagc
cacagcccggagggctccacggccacataccacctgctgggtccccaggaagagggtgaa
ggggtgctagatgtcaagggccaggtgaggatggaggtgcagggtgaggaggagaagagg
gaggacaaggaggatgaggacgatgaggatgatgacgtcagccatgtggatgaggaggac
gtccttggggtgcagagggaggaccgacggggcggcgatgggcagatcaatgagcaggta
gagaagctgcggcggccggaaggtgccagcaatgagactgagcgagactag

DBGET integrated database retrieval system