KEGG   Mus musculus (mouse): 56297Help
Entry
56297             CDS       T01002                                 

Gene name
Arl6, 1110018H24Rik, 2210411E14Rik, BBS3
Definition
(RefSeq) ADP-ribosylation factor-like 6
  KO
K07951  ADP-ribosylation factor-like protein 6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    56297 (Arl6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    56297 (Arl6)
   04031 GTP-binding proteins [BR:mmu04031]
    56297 (Arl6)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    56297 (Arl6)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   56297 (Arl6)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arl6
    56297 (Arl6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf G-alpha Roc Ras SRPRB Gtr1_RagA MMR_HSR1 AAA_22 GTP_EFTU AAA_18 FeoB_N AAA_7
Motif
Other DBs
NCBI-GeneID: 56297
NCBI-ProteinID: NP_062639
MGI: 1927136
Ensembl: ENSMUSG00000022722
Vega: OTTMUSG00000026308
UniProt: O88848 Q3TUM2
Position
16; 16 C1.3
AA seq 186 aa AA seqDB search
MGLLDRLSGLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQDIVPTIGFSIEKFKS
SSLSFTVFDMSGQGRYRNLWEHYYKDGQAIIFVIDSSDKLRMVVAKEELDTLLNHPDIKH
RRIPILFFANKMDLRDSVTSVKVSQLLCLESIKDKPWHICASDAIKGEGLQEGVDWLQDQ
IQAVKT
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgctggacagactttcaggtttgcttggcctgaagaagaaggaggttcatgtt
ctgtgcctggggctggataacagtgggaaaaccacaatcattaacaagctgaagccttcc
aacgctcaatctcaagatatagttccaaccataggatttagcatagagaaattcaagtcc
tccagtttgtcttttacagtgtttgacatgtcaggtcaaggaaggtacaggaatctctgg
gaacactattataaagatggacaagccattatttttgtcattgatagtagtgataagtta
agaatggttgtggccaaagaagagcttgatacccttctgaatcacccagatattaagcac
cgtcgaattccaatcttgttctttgcaaacaaaatggaccttagagactcagtgacctct
gtgaaagtgtctcagttgctgtgcttagagagcattaaagacaagccgtggcatatttgt
gctagtgacgccatcaaaggagaaggcctgcaggaaggcgtggactggctccaagatcag
atccaagctgtgaagacgtga

DBGET integrated database retrieval system