KEGG   Mus musculus (mouse): 56298Help
Entry
56298             CDS       T01002                                 

Gene name
Atl2, 2010110I21Rik, AA407293, AV334690, Aip-2, Arl6ip2
Definition
(RefSeq) atlastin GTPase 2
  KO
K17339  atlastin [EC:3.6.5.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    56298 (Atl2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     56298 (Atl2)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    56298 (Atl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GBP GBP_C Tiam_CC_Ex
Motif
Other DBs
NCBI-GeneID: 56298
NCBI-ProteinID: NP_062691
MGI: 1929492
Ensembl: ENSMUSG00000059811
UniProt: Q6PA06 Q8C081 Q8BYP9 Q9D873
Position
17; 17 E3
AA seq 583 aa AA seqDB search
MAEGDEAARRQQPQQGLRRRRQTSDSSVGVNHVSSTTSLGEDYEDDDLVNSDEVMKKPCP
VQIVLAHEDDHNFELDEEALEQILLQEHIRDLNIVVVSVAGAFRKGKSFLLDFMLRYMYN
KDSQSWIGGNNEPLTGFTWRGGCERETTGIQVWNEVFVIDRPNGTKVAVLLMDTQGAFDS
QSTIKDCATVFALSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYQKPFQTLM
FLIRDWSYPYEHSYGLEGGKQFLEKRLQVKQNQHEELQNVRKHIHNCFSNLGCFLLPHPG
LKVATNPSFDGRLKDIDEDFKRELRNLVPLLLAPENLVEKEISGSKVTCRDLVEYFKAYI
KIYQGEELPHPKSMLQATAEANNLAAVAGARDVYCKSMEQVCGGDKPYIAPSDLERKHLD
LKEVALKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPATLFA
VMFAMYIISGLTGFIGLNSIAVLCNLVMGLALTSLCTWAYVKYSGEFREIGTMIDQIAET
LWEQVLKPLGDNLMEENIRQSVTNSIKAGLTDQVSHHARLKTD
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggcggagggggacgaggcagcgcgaaggcagcagccgcagcaggggctgaggcgccgg
cgacagaccagcgactcgagcgtcggagttaaccacgtctcgtctacgacctccctaggt
gaggattatgaagatgatgacctagtaaactcagatgaggttatgaagaaaccatgccca
gtacagattgttctcgcccatgaagatgaccataactttgagcttgatgaagaggctttg
gagcagatcctgctgcaggagcacatacgggatcttaacatagtcgtggtgtctgtggca
ggagctttccgtaaagggaaatcatttctcctggacttcatgcttagatatatgtataac
aaggattctcaaagctggattggtggaaacaatgaacccttgactggctttacgtggcga
ggtggttgcgaaagagaaacaacaggcatacaagtttggaatgaagtgtttgtgattgac
agacctaatggaacaaaagtggctgtgctgctaatggatacccagggtgcctttgatagc
cagtcaaccattaaagactgtgcgacagtgtttgctctgagcactatgaccagctctgtg
caggtatataatttgtctcagaatattcaagaagatgatcttcaacatctacagttattt
acagagtatggaagacttgcaatggaagagatctaccagaagccatttcagacgctaatg
tttttgattcgagattggagttatccttatgagcactcatatggcttggaaggtgggaag
cagttccttgagaagagattacaggtgaagcagaaccagcacgaggagctgcagaacgtc
aggaagcacatccacaactgcttctcaaacctgggctgcttcctcctcccgcaccccggc
ctcaaagtcgccaccaaccctagctttgatggacgactgaaagatatcgatgaagacttt
aaacgggagcttcgaaatctggttccattgctgcttgctcctgaaaatcttgttgagaaa
gagataagtggatcgaaagtcacttgtagagatcttgtagagtattttaaggcatacatt
aaaatatatcaaggagaggaactaccacacccaaagtctatgcttcaggcaacagctgag
gctaataacctggcagcagtagcaggagcaagagatgtctattgtaaaagtatggagcag
gtatgcggtggtgataagccgtacattgcaccttcagatttggagcgaaaacacctggat
ctcaaggaagtggcgctcaaacagtttcgttctgtgaaaaaaatgggtggagatgaattc
tgccgccgttatcaggaccagcttgaagctgaaatcgaagaaacctatgcaaattttata
aagcacaatgatggcaaaaatatcttctatgctgctcgcacccctgccacactgtttgca
gtcatgtttgctatgtatatcatctcaggactgactggcttcattggcctaaactctata
gctgtcttatgcaacctcgtcatggggctagcactgacgtccctttgtacttgggcatat
gttaagtactctggggagttcagagaaatcggaacaatgattgatcagattgctgaaaca
ctgtgggaacaggtattgaagcccctgggtgataatttgatggaggaaaacataaggcag
tctgtaacaaactctatcaaagcaggcctgactgaccaggtgtctcatcatgcccgatta
aagacagactga

DBGET integrated database retrieval system