KEGG   Mus musculus (house mouse): 56306
Entry
56306             CDS       T01002                                 
Symbol
Sinhcaf, Fam60a, Ppcs1, Pptcs1, Tera
Name
(RefSeq) SIN3-HDAC complex associated factor
  KO
K26090  SIN3-HDAC complex-associated factor
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    56306 (Sinhcaf)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     56306 (Sinhcaf)
SSDB
Motif
Pfam: FAM60A
Other DBs
NCBI-GeneID: 56306
NCBI-ProteinID: NP_062617
MGI: 1929091
Ensembl: ENSMUSG00000039985
UniProt: Q8C8M1
Position
6:complement(148822555..148847968)
AA seq 221 aa
MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLV
KRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRMKSNQISKLQKEFKRHNS
DAHSTTSSASPAQSPCYSNQSDEGSDTEMASSSNRTPVFSFLDLTYWKRQKICCGIIYKG
RFGEVLIDTHLFKPCCSSKKAAAEKPEEQGPAPLPISTQEW
NT seq 666 nt   +upstreamnt  +downstreamnt
atgtttggttttcacaagccaaagatgtaccgaagtatagagggctgctgtatatgcaga
gccaagtcctccagctcccggttcacggacagtaaacgttacgaaaaggacttccagagc
tgttttgggttgcatgagactcgctcaggagacatctgtaatgcctgtgtgctgcttgtg
aaaagatggaagaagttgccggcaggatcaaaaaaaaactggaatcacgtggtagatgca
agagcaggccctagtctaaagacaacattgaaaccaaagaaagtgaaaactctatctgga
aacaggatgaaaagcaaccagatcagcaaactgcagaaggaatttaaacgccacaactct
gatgctcacagtaccacctcaagtgcctctccagcccagtctccatgctacagtaaccag
tcagatgagggctcagatacagagatggcttccagctctaatagaactccggttttttcc
ttcttagatcttacctactggaaaagacagaaaatatgttgtgggatcatctataaaggc
cgttttggggaagtcctcatcgacactcatctcttcaagccttgctgcagcagtaagaaa
gcagctgccgagaagcccgaggagcaggggccggcacctctgcccatctccactcaggag
tggtga

DBGET integrated database retrieval system