KEGG   Mus musculus (house mouse): 56307
Entry
56307             CDS       T01002                                 
Symbol
Metap2, 4930584B20Rik, A930035J23Rik, AI047573, AL024412, AU014659, Amp2, Mnpep, p67, p67eIF2
Name
(RefSeq) methionine aminopeptidase 2
  KO
K01265  methionyl aminopeptidase [EC:3.4.11.18]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    56307 (Metap2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     56307 (Metap2)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M24
   56307 (Metap2)
SSDB
Motif
Pfam: Peptidase_M24 CpG_bind_C
Other DBs
NCBI-GeneID: 56307
NCBI-ProteinID: NP_062622
MGI: 1929701
Ensembl: ENSMUSG00000036112
UniProt: O08663 Q58E65
Position
10:complement(93694351..93732952)
AA seq 478 aa
MAGVEQAASFGGHLNGDLDPDDREEGTSSTAEEAAKKKRRKKKKGKGAVSAVQQELDKES
GALVDEVAKQLESQALEEKERDDDDEDGDGDADGATGKKKKKKKKKRGPKVQTDPPSVPI
CDLYPNGVFPKGQECEYPPTQDGRTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVR
KYVMSWIKPGMTMIEICEKLEDCSRKLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTT
VLQYDDICKIDFGTHISGRIIDCAFTVTFNPKYDILLTAVKDATNTGIKCAGIDVRLCDV
GEAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGPYRIHAGKTVPIVKGGEATRMEEGEV
YAIETFGSTGKGVVHDDMECSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWL
DRLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggcgggcgtggagcaggcagcgtccttcgggggccacctgaatggcgacctggatcca
gacgacagggaagagggaacctccagcacggccgaggaagccgccaagaagaaaagacgg
aagaagaagaagggcaaaggggctgtgtcagcagtgcaacaagaacttgataaagaatcc
ggagccttggtggatgaagtagcaaaacagctggagagccaagcactggaggagaaggag
agagatgacgacgatgaagatggagatggtgatgctgatggtgcaactgggaagaagaag
aaaaagaagaagaagaagagaggaccaaaagttcaaacagaccctccctcagttccaata
tgtgacctgtatcctaatggtgtatttcccaaaggacaagagtgtgaatacccacccaca
caagatgggcggacagctgcttggagaaccacaagtgaggaaaaaaaggccctagaccag
gccagtgaggagatctggaacgacttccgagaagctgcggaggcacatcggcaagttagg
aaatatgtcatgagctggatcaagcctgggatgacgatgatagaaatctgtgagaagttg
gaagactgttcccgaaagctaataaaggaaaatgggttaaatgcaggcctggcgttcccc
actgggtgttctctcaacaactgtgctgcccattacactcccaatgctggtgacacgaca
gtcttgcagtatgatgacatctgtaagatagactttggaacacatataagtggtagaata
atcgattgtgcttttactgttacttttaatcccaaatatgacatactattaacagctgta
aaggatgccactaatactggaataaagtgtgctgggattgacgttcgtctctgcgatgtc
ggtgaggccattcaagaagttatggaatcctatgaagtagaaatagatgggaagacatac
caagtgaaacccatacgtaacttaaatggacattcaattgggccatatagaattcacgct
ggaaaaacggtgcccattgtgaaaggaggggaagctacaagaatggaggaaggagaggtg
tatgccattgagacctttgggagcacggggaagggcgtggttcatgacgacatggaatgt
tcacactacatgaaaaattttgatgtggggcacgtgccaataaggcttccaagaacaaaa
cacttgttaaatgtcatcaacgaaaacttcggtacccttgccttctgccgaaggtggctg
gatcgcttgggagaaagtaaatacttgatggctctgaagaatctgtgtgacttgggcatt
gtagatccatacccaccactgtgtgacattaaagggtcatatacagcacagtttgaacac
actatactgttgcgtccaacctgtaaagaagttgtcagcagaggagatgactattaa

DBGET integrated database retrieval system