KEGG   Mus musculus (mouse): 56309
Entry
56309             CDS       T01002                                 

Symbol
Mycbp, 5730488M09Rik, AW552132, AW742590, Amy-, Amy-1
Name
(RefSeq) MYC binding protein
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: TSC22 ZapB
Other DBs
NCBI-GeneID: 56309
NCBI-ProteinID: NP_062634
MGI: 1891750
Ensembl: ENSMUSG00000028647
Vega: OTTMUSG00000008990
UniProt: Q9EQS3
Position
4; 4 D2.2
AA seq 103 aa
MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPTSALDFLKHHLGAATPENP
EIELLRLELAEMKEKYEATVEENKKLKAKLVQYEPPQEEKRAE
NT seq 312 nt   +upstreamnt  +downstreamnt
atggcccattacaaagccgccgactcgaagcgcgagcagttccggaggtacttggagaag
tcgggggtgctggacacgctgacgaaagtgttggtagccttatatgaagaaccagagaag
cccaccagtgctctggattttttaaagcatcacttaggagctgctaccccggaaaaccca
gaaatagagctgcttcgcctagaattggcagaaatgaaagagaaatatgaagctactgta
gaagaaaataaaaaactgaaagcaaagcttgttcagtatgaaccacctcaggaggagaag
cgtgctgaatag

DBGET integrated database retrieval system