KEGG   Mus musculus (mouse): 56314
Entry
56314             CDS       T01002                                 

Symbol
Zfp113, 4732456B05Rik, mKIAA4229
Name
(RefSeq) zinc finger protein 113
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    56314 (Zfp113)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    56314 (Zfp113)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    56314 (Zfp113)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 XPA_N zf-C2H2_jaz zf-C2H2_11 zinc_ribbon_15 C1_1 zf-H2C2_5
Other DBs
NCBI-GeneID: 56314
NCBI-ProteinID: NP_062721
MGI: 1929116
Ensembl: ENSMUSG00000037007
Vega: OTTMUSG00000022637
UniProt: Q8C689 Q5DTG4
Position
5; 5 G2
AA seq 439 aa
METQADHASQAPLPLLESALSSSKVPSFPDKDSLGDKMLAAALLKAKSQELVTFEDVAVY
FIWREWKRLEPAQRDLYRDVMLENYGNVFSLDGDSKTGNDRVISEGMGSCEMILGRFQKD
VSQGLKFEEAYEQEVSLQRQLGNSSVGRLNRKIQEFHQVRVEEKLTHIGERNKKYSEFGN
SFTVNSKLISHQRLQMGDKPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECSECGKAFSQ
SAHLIQHQRIHTGEKPYECKDCGKTFSCSSALILHQRIHTGEKPYECNECGKTFSWSSTL
THHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQ
RIHTGEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHT
GEKPLTVMGVKQKLSQSLC
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggaaacccaggcagaccatgcatctcaggcacctctgcccctgttagagagcgctctt
tcttcttcaaaagtcccttcctttcctgacaaggacagtctgggggacaagatgttggct
gctgcgcttctaaaggccaagtctcaggagttggtgacctttgaggatgtagctgtgtac
ttcatctggagagagtggaagcgtctggagcctgcacaaagggacctctacagagatgtg
atgctggagaactatgggaacgtgttctcactggatggcgattccaaaactggaaatgat
cgagtaatctctgaaggtatggggtcatgtgagatgatactggggcgattccaaaaggat
gtttctcagggtcttaagtttgaagaagcctacgaacaagaagtcagtctgcaaaggcag
ctagggaattcctctgttggaagactgaataggaaaatacaagagtttcaccaagttaga
gttgaggaaaagctcacccatattggagaaagaaataagaagtacagtgagtttggaaac
agcttcactgtgaattccaaacttatttcacatcaaagacttcagatgggagacaaaccc
cataagtgtgatgaatgtagcaagagttttaatcgtacttcagaccttattcaacatcag
agaatccacactggagaaaaaccctatgaatgtagtgaatgtggaaaggccttcagtcag
agcgcacatcttattcagcaccagagaatccacactggagaaaaaccttatgagtgtaag
gattgtgggaagaccttcagttgtagctctgctctcattctgcatcagagaatccacact
ggggagaagccttatgaatgtaacgagtgtgggaaaacctttagctggagctccactctc
actcaccaccagagaatccacacaggggagaagccctatgcttgcaatgagtgtgggaag
gccttcagcaggagctccacccttattcatcatcagagaatccacactggagagaagccc
tatgaatgtaatgagtgtgggaaagccttcagccagagctcacacctctatcagcaccag
agaatccacactggagagaagccctatgaatgtatggaatgtggagggaagtttacctac
agttccggccttattcaacatcagcgaatccacacaggggagaatccctatgaatgtagc
gagtgtgggaaagccttcaggtacagctcagcacttgttcgccatcagaggattcacact
ggagagaagcctttgactgtaatgggtgtaaagcaaaaactctctcagagcctctgctga

DBGET integrated database retrieval system