KEGG   Mus musculus (mouse): 56325Help
Entry
56325             CDS       T01002                                 

Gene name
Abcb9, TAPL, mKIAA1520
Definition
(RefSeq) ATP-binding cassette, sub-family B (MDR/TAP), member 9
  KO
K05656  ATP-binding cassette, subfamily B (MDR/TAP), member 9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    56325 (Abcb9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    56325 (Abcb9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    56325 (Abcb9)
Transporters [BR:mmu02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB2, 3, 8, 9, 10 subgroups
    56325 (Abcb9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 AAA_22 RsgA_GTPase ABC_membrane_3 MCU AAA_29 AAA_30 DUF4191 AAA_23 AAA_15
Motif
Other DBs
NCBI-GeneID: 56325
NCBI-ProteinID: NP_063928
MGI: 1861729
Ensembl: ENSMUSG00000029408
Vega: OTTMUSG00000028882
UniProt: Q9JJ59
Position
5; 5 F
AA seq 762 aa AA seqDB search
MRLWKAVVVTLAFVSTDVGVTTAIYAFSHLDRSLLEDIRHFNIFDSVLDLWAACLYRSCL
LLGATIGVAKNSALGPRRLRASWLVITLVCLFVGIYAMAKLLLFSEVRRPIRDPWFWALF
VWTYISLAASFLLWGLLATVRPDAEALEPGNEGFHGEGGAPAEQASGATLQKLLSYTKPD
VAFLVAASFFLIVAALGETFLPYYTGRAIDSIVIQKSMDQFTTAVVVVCLLAIGSSLAAG
IRGGIFTLVFARLNIRLRNCLFRSLVSQETSFFDENRTGDLISRLTSDTTMVSDLVSQNI
NIFLRNTVKVTGVVVFMFSLSWQLSLVTFMGFPIIMMVSNIYGKYYKRLSKEVQSALARA
STTAEETISAMKTVRSFANEEEEAEVFLRKLQQVYKLNRKEAAAYMSYVWGSGLTLLVVQ
VSILYYGGHLVISGQMSSGNLIAFIIYEFVLGDCMESVGSVYSGLMQGVGAAEKVFEFID
RQPTMVHDGSLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGPSGSG
KSSCVNILENFYPLQGGRVLLDGKPIGAYDHKYLHRVISLVSQEPVLFARSITDNISYGL
PTVPFEMVVEAAQKANAHGFIMELQDGYSTETGEKGAQLSGGQKQRVAMARALVRNPPVL
ILDEATSALDAESEYLIQQAIHGNLQRHTVLIIAHRLSTVERAHLIVVLDKGRVVQQGTH
QQLLAQGGLYAKLVQRQMLGLEHPLDYTASHKEPPSNTEHKA
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgtggaaggcggtagtagtgacgctggccttcgtgagcacggacgtcggggtg
accacggccatctacgccttcagccacctggaccgtagcctgctggaggacatccgacac
tttaacatcttcgactcggtgctggacctctgggctgcctgcctgtaccgcagctgcctg
ctgctgggggctaccataggcgtggccaagaacagcgctctggggccaaggcgcctgcgg
gcttcgtggctcgtcatcaccctcgtgtgcctctttgtgggcatctatgccatggccaaa
ctgctactcttctcagaagtgcgcaggcccatccgggacccatggttctgggcgctcttc
gtgtggacctacatctcgctggctgcctccttcctgctgtgggggctgctggccactgtg
cggccggacgcagaggccctggagccagggaatgagggcttccacggggagggtggggcc
cctgctgagcaggcatcgggagccacactacagaagctgttgtcctacacaaagcctgac
gtggccttcctagtagctgcctcctttttcctcatcgtagcagctctgggtgagaccttc
ctgccctactacactggccgggccattgacagcattgtgatccagaaaagcatggatcag
ttcaccacagccgttgtcgtcgtttgcctgctggccatcggcagctcattggccgcaggt
attcggggcggtattttcaccctcgtatttgccagactgaacattcgcctccggaactgt
ctcttccgctcactggtgtcacaggagacaagcttctttgatgagaaccgcacaggggac
ctcatctcccgcctcacctctgataccaccatggtcagcgacctggtctcccagaacatc
aacatcttcctgaggaacacggtcaaagtcacgggcgtggtggtcttcatgttcagcctc
tcctggcagctttccctggtcaccttcatgggcttccctatcatcatgatggtgtccaac
atctacggcaagtactacaagaggctctccaaggaggtccagagcgccctggccagagcc
agcaccacagccgaggaaaccatcagcgcgatgaagacggtgcgcagctttgccaacgag
gaggaggaggccgaggtgttcctgcggaagcttcagcaggtgtacaagctcaacaggaag
gaagcagcggcctacatgtcctacgtctggggcagcgggctcacactcctggtggtccag
gtcagtattctctactacgggggccacctagtcatctcggggcagatgagcagcggcaac
ctcatcgccttcatcatctacgaatttgtcctgggagactgcatggagtccgtgggctcc
gtctacagtggcctgatgcagggagtgggggccgccgagaaggtgttcgagttcatcgac
cggcagcccaccatggtgcatgacggaagcttggcccccgaccacctcgagggcagggtg
gactttgagaatgtgaccttcacctaccgcactcggccccacacacaggtcctacagaat
gtctccttcagcctgtcccccggcaaggtgacagctctggtggggccgtcgggcagcggg
aagagctcgtgtgtgaacatcctggagaacttctaccctctgcagggcggccgtgtattg
ttggatggcaagcccattggcgcctatgaccacaagtacctgcatcgtgtgatctcactg
gtgagccaggagcccgtgctgttcgcccgctccatcacagacaacatctcctacggcctg
cctaccgtgcccttcgagatggtggtggaggctgcacagaaggccaatgcccatggcttc
atcatggaactgcaggacgggtacagcacagagaccggggagaagggagcccagctgtca
ggtgggcagaagcagcgggtggccatggcccgagcacttgtgcggaacccacctgtgctt
atcctggacgaagccaccagtgccctggatgccgagagcgaatacctgattcagcaggcc
atccacggcaacctgcagagacacacggtgctcatcattgcacaccggctgagcaccgtg
gagcgggcacacctcatcgtggtgctggacaagggccgggtggtacagcagggcacacac
cagcagctgttggcacagggcggcctctatgccaagctggtgcagcgtcagatgttgggg
ctcgagcaccccttggactacacagccagccacaaggagccacccagcaacactgaacac
aaggcctga

DBGET integrated database retrieval system