KEGG   Mus musculus (mouse): 56327
Entry
56327             CDS       T01002                                 

Gene name
Arl2, 2610009M23Rik, AI115441, AW553335
Definition
(RefSeq) ADP-ribosylation factor-like 2
  KO
K07943  ADP-ribosylation factor-like protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    56327 (Arl2)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    56327 (Arl2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    56327 (Arl2)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arl2/Arl3
    56327 (Arl2)
SSDB
Motif
Pfam: Arf Roc SRPRB G-alpha Ras Gtr1_RagA MMR_HSR1 TniB GTP_EFTU MeaB
Other DBs
NCBI-GeneID: 56327
NCBI-ProteinID: NP_062696
MGI: 1928393
Ensembl: ENSMUSG00000024944
Vega: OTTMUSG00000018610
UniProt: Q9D0J4
Structure
PDB: 
1KSH 1KSG 4GOK 1KSJ

Position
19; 19 A
AA seq 184 aa
MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDVDTISPTLGFNIKTLEHRGF
KLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATL
LIFANKQDLPGALSCNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWLLDDISSRV
FTAD
NT seq 555 nt   +upstreamnt  +downstreamnt
atggggcttctgaccattctgaagaagatgaagcagaaagagcgagagctgcggctgctc
atgcttggcttggacaacgctggcaaaacaaccatcctcaagaagttcaatggagaagac
gtggacaccatctccccgacactgggcttcaacatcaagaccctggagcaccgcggattc
aagctgaacatctgggatgtaggtggccagaagtctctgcgctcctactggaggaactac
tttgagagcacggatggcctcatctgggtggtggacagcgccgaccgccagcgcatgcag
gactgtcagcgagagctgcagagcctactggtggaggagcgcctggctggagcaaccctc
ctcatctttgccaacaagcaggacctgcctggagcactgtcctgtaatgctattcaggag
gccctggagctggactccatccgcagccaccactggcgcatccagggctgcagtgctgtc
acaggggaagacctgctgcctggcatcgactggctccttgatgacatttccagtcgtgtc
tttactgccgactga

DBGET integrated database retrieval system