KEGG   Mus musculus (mouse): 56332
Entry
56332             CDS       T01002                                 

Symbol
Amotl2, AW549739, C79691, Lccp, MASCOT, mKIAA0989
Name
(RefSeq) angiomotin-like 2
  KO
K06104  angiomotin like
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04530  Tight junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    56332 (Amotl2)
SSDB
Motif
Pfam: Angiomotin_C
Other DBs
NCBI-GeneID: 56332
NCBI-ProteinID: NP_062738
MGI: 1929286
Ensembl: ENSMUSG00000032531
Vega: OTTMUSG00000033309
UniProt: Q8K371
Position
9:102594290..102610616
AA seq 772 aa
MRTLEDSSGTVLHRLIQEQLRYGNLTETRTLLAIQQQALRGGAGAGGTGSPQASLEIGAP
EDSQVLQQATRQEPQGQEHQGGETHLAENRLYRLCPQPSKGEELPTYEEAKAHSQYYAAQ
QAGSRPHVGDRDPRGGVSGGGRRQDEALRELRHGHVRSLSERLLQLSLERNGARVPSHMS
SSHSFPQLARSQQGPQPRGPPAEGPEPRGPPPQYPHAVMAQETAAVTDPRYRPRSSPHFQ
HAEVRILQAQVPPVFLQQQQYQYLPQPQEHSPPLHPAALGHGPPSSFGPPAVEGPPSAQA
TLGSAHLAQMETVLRENARLQRDNERLQRELESTSEKAGRIEKLENEIQRLSEAHESLMR
TSSKREALEKTMRNKMDGEMRRLQDFNRDLRERLESANRHLASKTQEAQAGSQDMVAKLL
AQSYEQQQEQEKLEREMALLRGAIEDQRRHAELLEQALGNAQSRAARAEEELRKKQAYVE
KVERLQQALGQLQAACEKREQLELRLRTRLEQELKALRAQQRQTGTLAGGGGSHGGSAEL
SALRLSEQLREKEEQILALEADMTKWEQKYLEERAMRQFAMDAAATAAAQRDTTLIRHSP
QPSPSSSFNEGLLPGNHRHQEMESRLKVLHAQILEKDAVIKVLQQRSRKDPGKATQGTLR
PAKSVPSIFAAAVGTQGWQGLVSSERQTDARPAGDRVPAEEPPATAPLPAHTKHGSRDGS
TQTDGPADNTSACLASEPDGLLGCNSSQRTPSLDSIAATRVQDLSDMVEILI
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgaggacactggaagactcctcagggacagtcctgcaccgtctcatccaagagcagctg
cgctacggcaacctgacagagactcgcactctgctggctatccagcagcaggccctgcgg
ggtggggctggagctgggggcacggggagcccccaggcttccttggagatcggagcaccc
gaggacagtcaggtgctgcagcaagccaccaggcaggagccccagggccaggagcatcag
ggtggagagacccacctggcagagaacaggctgtaccggctgtgcccacagcccagcaaa
ggagaagagttgcccacctatgaggaggccaaagcccattcgcagtactacgcagcgcag
caggcagggtcccggccgcatgttggggaccgggatcctagaggaggggtgtccggaggc
ggccggcgacaggatgaagctcttcgagagctgaggcatggccatgtgcgctccttgagt
gaacggcttctgcaactgtccctggaaagaaacggtgctcgggtccccagccacatgagc
tcttcccacagcttccctcagctggcccgcagccagcagggcccccaaccccgagggccc
ccagctgagggcccagagccccgcgggccaccacctcagtacccacacgctgtaatggct
caggagactgcggctgtcactgacccaagataccgaccccgaagcagcccacacttccag
catgccgaagtcaggatcctgcaggcccaggtaccaccggtgttcctccagcagcagcag
taccagtacctgccacagccccaggagcactctccacccctccacccggcagctctgggc
catggacccccaagctcctttggtccacctgcagtggagggaccacccagtgcccaggcc
accttgggcagtgcccacctggcccagatggagactgtactgagggagaatgccaggctg
cagagggacaatgagcgattgcagagagagctggagagcacttcagagaaggctggccgc
atagaaaagctggaaaatgaaatccagcggctctctgaggcccacgagagcctgatgagg
acctcttccaagcgtgaggccctggagaagaccatgaggaacaagatggacggtgagatg
agacggttgcaggacttcaaccgagaccttagagagagattggaatcggcaaaccgccac
ctggcaagcaagacccaggaagcccaggcgggcagtcaggacatggtggcgaaactgctt
gcccagagctatgagcagcaacaggaacaggagaagctggagcgggagatggcactgctg
cgtggtgccatcgaggaccagcggcgacatgctgaactgctggagcaggctctgggcaat
gcacaaagccgtgccgcccgggctgaagaggagctacgcaaaaagcaggcctatgtggag
aaggtggagcggctgcagcaggcactggggcagttgcaggctgcctgtgaaaagcgagag
cagttggagctgcgtctgcgcacgcgcctggagcaggaactcaaagccttgcgtgcacag
cagaggcagacaggcaccctcgcaggtggtggcggcagccatggtgggtccgccgagctc
agtgccctgcggctgtctgaacagctgcgggagaaggaggaacagatcctggctctagag
gcggacatgaccaagtgggaacagaagtatttggaagaacgggctatgaggcagttcgcc
atggacgcggctgccactgcggctgcccagcgcgataccactctcatccggcactccccc
cagccctcgcccagcagcagtttcaacgagggcctgctgccaggcaaccacaggcaccag
gagatggagagcagattgaaggtgctccatgctcagatcctagagaaggatgcggtgatc
aaggtccttcagcagcgctccaggaaagaccctggcaaggccacccagggcaccctacgg
cctgccaagtcggtgccgtccatcttcgcggctgcagtgggaactcagggctggcaaggg
ctcgtatccagtgagcggcaaactgatgcacggccagcgggagaccgggtcccagcagag
gagcctccggccacagctcctctccctgcccacaccaaacatggcagcagagacgggagc
acccagacggatggccctgcagacaacacctctgcctgcttggcctcagaacccgatggc
ctcctggggtgcaacagtagccagaggacaccctctctggactctatagctgcaaccaga
gtccaggatctgtcagacatggtagaaatactgatctga

DBGET integrated database retrieval system