KEGG   Mus musculus (mouse): 56347Help
Entry
56347             CDS       T01002                                 

Gene name
Eif3c, 110kDa, 3230401O13Rik, Eif3s8, NIPIL(A3), NipilA3, Xs, Xsl
Definition
(RefSeq) eukaryotic translation initiation factor 3, subunit C
  KO
K03252  translation initiation factor 3 subunit C
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    56347 (Eif3c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmu03012]
    56347 (Eif3c)
Translation factors [BR:mmu03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    56347 (Eif3c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
NCBI-GeneID: 56347
NCBI-ProteinID: NP_666312
MGI: 1926966
Ensembl: ENSMUSG00000030738
Vega: OTTMUSG00000042475
UniProt: Q8R1B4
Position
7 69.14 cM; 7 F3
AA seq 911 aa AA seqDB search
MSRFFTTGSDSESESSLSGEELVTKPVSGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEEL
TNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNEL
WEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITNYKQNPEQSADEDAEKNEEDSEG
SSDEDEDEDGVGNTTFLKKKQESSGESRKFHKKMEDDDEDSEDSEDEEWDTSSTSSDSDS
EEEEGKQTVLASKFLKKAPTTEEDKKAAEKKREDKAKKKHDRKSKRLDEEEEDNEGGEWE
RVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEILQVRGKKGTDRATQIELLQLLVQIAA
ENNLGVGVIVKIKFNIIASLYDYNPNLATYMKPEMWQMCLDCINELMDTLVAHSNIFVGE
NILEESENLHNFDQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAI
IERVQRYLEEKGTTEEICQIYLRRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGE
DSAVLMERLCKYIYAKDRTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHAD
PPVQILYNRTMVQLGICAFRQGLTKDAHNALLDIQSSGRAKELLGQGLLLRSLQERNQEQ
EKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGE
RQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRK
IQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTV
VMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTYGGYFRDQKDGYRKNEGYMRRG
GYRQQQSQTAY
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgattcttcaccaccggctcggacagtgagtcggagtcgtccctgtccggggag
gagctcgtcaccaaaccggtctccgggaactacggcaaacagcctttgttactgagcgag
gatgaggaggatacaaagagagttgtccgaagcgccaaggacaagaggtttgaggagctg
accaacctcatacgaaccatccgtaatgccatgaagattcgagatgtcaccaagtgtcta
gaagagtttgagctcctgggaaaggcctatgggaaagccaagagtattgtggataaggaa
ggtgtcccccgattctacatccgaatactggctgacctggaggactatcttaatgagctt
tgggaagataaagaaggaaagaagaagatgaataaaaacaacgccaaggctctgagtacc
ttgcgccagaagatccggaaatacaaccgagatttcgagtcacacatcaccaactacaag
cagaaccctgagcagtctgcagatgaagatgcagaaaagaatgaggaagactccgaaggc
tcttcagatgaggatgaggacgaggacggagtcggtaatacgactttcttgaagaagaag
caagaatcttctggagagagtcggaagttccacaaaaagatggaagatgatgatgaggac
tctgaagattctgaagatgaagaatgggacaccagctccacatcttctgattcagactct
gaggaagaagaaggaaaacaaactgttctggcctcaaagttccttaaaaaggcacccact
acagaggaggacaaaaaagcagctgaaaagaaacgggaagacaaagccaagaagaagcac
gataggaagtctaagcgcctggatgaggaagaggaggacaatgagggcggggagtgggaa
cgggtccgaggtggcgtaccacttgttaaggaaaagccaaaaatgtttgccaagggaact
gagatcactcatgctgttgtcatcaagaaactgaatgagattctacaggtcagaggcaag
aagggaacagaccgtgccactcagattgaattgctccagctgctggttcagattgctgct
gaaaacaacctgggggtgggcgtcattgtcaagatcaagttcaatatcattgcctctctc
tacgattacaaccctaacctggccacgtacatgaagccagagatgtggcagatgtgccta
gactgcatcaatgaactgatggatacgttggttgcacattccaacatctttgttggagag
aacattttggaagagagtgagaacttacacaactttgatcagccactgcgtgtacgaggc
tgcatcctaactttggtggagcgaatggatgaagaatttaccaaaataatgcaaaatact
gatcctcactcccaagagtatgtggagcacctgaaggatgaggcacaagtgtgtgccatc
attgagcgagtgcagcgctacctggaggagaaaggtaccactgaggagatctgccagatc
tacttaaggcgcatcctgcacacgtactacaagtttgactacaaggcccatcagcggcag
cttactcctcctgaaggatcctcaaagtctgagcaagaccaggcagaaaatgagggtgag
gactcagctgtgctaatggaaagactgtgcaagtacatctatgccaaggaccgtacagac
cggatccgtacctgtgccatcctctgccatatctaccatcatgcgctccactcccgctgg
tatcaggcccgtgacctcatgctcatgagccacctacaggacaacattcagcacgcagac
ccgccggtgcagatcctgtataaccgtactatggtgcaactgggcatctgtgctttccgc
caaggcctgacaaaggatgcacacaatgcacttctggatattcagtcaagtggtcgtgcc
aaggagcttctaggtcagggtctgctgctgcgcagcctgcaggagcgaaatcaggaacag
gaaaaggtagagcgacgccggcaggtgccctttcacctgcacatcaacctggagctgctg
gagtgtgtctatctggtgtcagctatgctcctggagatcccctacatggctgcccatgag
agcgatgcccgccgacgcatgatcagcaagcagttccaccaccaactgcgggtgggcgag
cggcagcccctgctaggtcctcccgagtcaatgagggagcatgtggtcgctgcctccaag
gccatgaagatgggcgactggaagacctgccacagtttcatcattaatgaaaagatgaat
gggaaagtgtgggaccttttccctgaggctgacaaagttcgcaccatgctagttcggaag
atccaggaagagtctctgaggacctacctttttacctacagcagtgtctatgactcaatc
agtatggagacactatcagatatgtttgagctggatctacccactgttcactccatcatc
agcaagatgatcattaacgaagaattgatggcttccctggaccagccgacacagactgtg
gtgatgcaccgtactgagcccactgcccagcagaacttggctctgcagctggctgagaag
cttggcagcctagtggagaataatgaacgggtgtttgaccataagcagggaacctatggt
ggctatttccgagaccaaaaggatggctaccgaaaaaatgaaggctatatgcgccgtggt
ggctaccgccagcagcagtctcagacagcctactga

DBGET integrated database retrieval system