KEGG   Mus musculus (mouse): 56350Help
Entry
56350             CDS       T01002                                 

Gene name
Arl3
Definition
(RefSeq) ADP-ribosylation factor-like 3
  KO
K07944  ADP-ribosylation factor-like protein 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    56350 (Arl3)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    56350 (Arl3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    56350 (Arl3)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arl2/Arl3
    56350 (Arl3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf Roc G-alpha SRPRB Ras Gtr1_RagA MMR_HSR1 GTP_EFTU AAA PduV-EutP cobW AAA_18 AAA_14 FeoB_N AAA_16 AAA_28
Motif
Other DBs
NCBI-GeneID: 56350
NCBI-ProteinID: NP_062692
MGI: 1929699
Ensembl: ENSMUSG00000025035
UniProt: Q9WUL7 Q543P7
Structure
PDB: 

Position
19; 19 C3
AA seq 182 aa AA seqDB search
MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQG
FKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVP
VLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAK
KK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgctctctattttgcgcaaattgaaaagtgcaccagaccaggaggtgcgaatc
ctactcctgggcttggacaacgcgggcaagactaccttgctgaagcaactcgcatctgaa
gacatcagccacatcacacctacacagggatttaacatcaaaagcgtgcagtcacaaggt
tttaagctgaatgtatgggacattggcgggcagaggaaaatcagaccatactggagaagt
tattttgaaaatactgatattctcatctatgtaattgacagtgccgacagaaagagattt
gaagagacgggtcaggaactaacggaattactggaggaagaaaagctgagttgtgtgccc
gtgctcatctttgctaacaagcaggacctgctcacggcagccccagcctccgagatcgca
gaagggctaaacctccacaccatccgggaccgcgtctggcagatccagtcctgttcagcg
ctcacaggcgagggcgtccaggatggcatgaactgggtctgcaagaatgtcaacgcaaag
aagaaataa

DBGET integrated database retrieval system