KEGG   Mus musculus (mouse): 56356
Entry
56356             CDS       T01002                                 

Gene name
Gltp, 1110001F24Rik, C76925, C77564
Definition
(RefSeq) glycolipid transfer protein
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: GLTP
Other DBs
NCBI-GeneID: 56356
NCBI-ProteinID: NP_062795
MGI: 1929253
Ensembl: ENSMUSG00000011884
Vega: OTTMUSG00000014502
UniProt: Q9JL62
Position
5; 5 F
AA seq 209 aa
MALLAEHLLKPLPADRQIETGPFLEAVAHLPPFFDCLGSPVFTPIKADISGNITKIKAVY
DTDPAKFKTLQNILEVEKGMYGAEWPKVGATLALLWLKRGLRFIQVFLQSICDGERDENH
PNLIRVNANKAYEMALKKYHGWLVQKIFKAALYAAPYKSDFLKALSKGQNVTEEECLEKI
RLFLVNYTATIDAIYDMYTKMNAELDYTV
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcgctgctggccgagcacctgctcaagccgctgcccgcagaccggcagatcgagacc
gggcccttcctggaggctgtggctcacctgccgcccttctttgattgccttgggtccccg
gtattcacgcccatcaaggcagacataagcggtaacatcaccaaaatcaaagccgtatat
gacaccgacccagccaagttcaagaccctgcagaacatcctggaggtggagaaggggatg
tatggggcggagtggcctaaagtgggggccactctggcactgctgtggctgaaaaggggc
ctgcgcttcatccaggtgttcctgcagagcatctgcgatggggaacgcgacgagaaccac
cccaacctcatccgagtcaacgccaacaaggcctatgagatggccctgaagaagtaccat
ggctggctggtgcagaagatcttcaaggccgccctgtacgcagcaccttacaagtccgac
ttcctcaaggcactctccaaggggcagaacgtgacagaggaggagtgcctggagaagatc
cgcctcttcctggtcaactacacggccaccattgacgccatctacgacatgtacaccaag
atgaatgcggagcttgactacacagtgtag

DBGET integrated database retrieval system