KEGG   Mus musculus (house mouse): 56358
Entry
56358             CDS       T01002                                 
Symbol
Copz2, 1110012D12Rik, zeta2-COP
Name
(RefSeq) coatomer protein complex, subunit zeta 2
  KO
K20472  coatomer subunit zeta
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    56358 (Copz2)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    56358 (Copz2)
SSDB
Motif
Pfam: Clat_adaptor_s
Other DBs
NCBI-GeneID: 56358
NCBI-ProteinID: NP_063930
MGI: 1929008
Ensembl: ENSMUSG00000018672
UniProt: Q9JHH9
Position
11:96740702..96752029
AA seq 205 aa
MQRPEAWPRPHPGEGASAAQAGGAAPPTRATEQREPSLYTIKAVFILDNDGRRLLAKYYD
DTFPSVKEQMVFEKNVFNKTSRTESEIAFLGGMTIVYKSSIDIFLYVVGSSSENELMLMS
VLACLFDSLSHILRKNVEKRWLLENMDGAFLVLDETVDGGVILESDPQQVIQKVNFRTDD
SGLTEQSVAQVLQSAKEQIKWSLLK
NT seq 618 nt   +upstreamnt  +downstreamnt
atgcagcggccggaggcctggccacgtccgcacccgggggagggggcctcagccgcccaa
gccgggggcgcagcgccgcccacccgagccacggaacagcgggaaccttctctctacacc
atcaaggctgtcttcatcttagataatgacgggcgaaggctgctggccaagtattatgac
gacacatttccctccgtgaaggagcagatggttttcgagaaaaatgtcttcaacaagacc
agccgcaccgaaagtgaaattgcatttttggggggcatgactatcgtctacaagagcagc
attgacatcttcctgtatgtggtgggatcttcctccgagaatgagctgatgctcatgtct
gtgcttgcctgcctgtttgactctctgagccacatcttaaggaagaacgtggagaaacgc
tggttgctggagaacatggacggagccttcttggtgctggatgaaactgtcgatggaggt
gtgattctggagagcgacccccagcaagtgatccagaaagtgaattttaggactgatgac
agtggcctaacagaacagagtgtggcccaggttcttcagtcagccaaggaacagattaaa
tggtcgctattgaaatga

DBGET integrated database retrieval system