KEGG   Mus musculus (mouse): 56365
Entry
56365             CDS       T01002                                 

Gene name
Clcnkb, CLCKB, ClC-K, Clc-Ka, Clck, Clck2, Clcn, Clcnk1l, Clcnk2
Definition
(RefSeq) chloride channel, voltage-sensitive Kb
  KO
K05018  chloride channel Kb
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04966  Collecting duct acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    56365 (Clcnkb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    56365 (Clcnkb)
Ion channels [BR:mmu04040]
 Chloride channels
  Chloride channel (CLC)
   56365 (Clcnkb)
SSDB
Motif
Pfam: Voltage_CLC CBS
Other DBs
NCBI-GeneID: 56365
NCBI-ProteinID: NP_062675
MGI: 1930643
Ensembl: ENSMUSG00000006216
Vega: OTTMUSG00000010299
UniProt: Q9WUB6
Position
4; 4 D3
AA seq 687 aa
MEELVGLREGASKKPVPLQELWGPCPRIRRNIQGGLEWLKERLFRVGEDWYFLVALGVLM
ALISYAMNFTIGRVVRAHKWLYREIGDGHLLRYLSWTVYPVALLSFSSGFSQSITPSSGG
SGIPEVKTILTGVVLEDYLDIKNFGAKVVGLSCTLATGSTIFLGKLGPFVHLSVMIAAYL
GRVRTKTVGEPESKTKEMELLAAGAAVGVATVFAAPISGVLFSIEVMSSHFSVWDYWRGF
FAATCGAFMFHLLAVFNNEQETITSIYKTSFPVDIPFDLPEIFFFVALGAICGILSCGYN
YSQRTFLFFLKANGFTSKLLATSKPLYSALAAVVLASITYPPGVGHFMASRLSMSEHLET
LFDNNSWALMTKNSSPPWAAEPDPQKLWLEWCHPQLTVFGTLVFFLVMKFWMLILATTIP
IPAGYFLPIFIYGAVIGRLFGEVLSVAFPEGIVAGGRVNPIMPGAYALAGAAAFSGAVTH
TLSTALLAFEVTGQLVHALPVLMAVLAANAISQSFQPSFYDGTIIVKKLPYLPWIRGRQI
GSHSVTVGHFMNCALTTLAKDMPLEQVIQVVISTDVTQYPLVETTESQTLVGVVKRTHLV
QALQTEPASWAPGQQPCLQDILANGCPTQPVTLQLSLETSLHETHNLFELLNLQTLFVTS
RGRAVGSVSWVELKKAISTLTNPPAPK
NT seq 2064 nt   +upstreamnt  +downstreamnt
atggaggaattagtggggcttcgtgagggcgcctccaagaagccagtgccactgcaagaa
ctctgggggccatgcccacgcatccgcagaaacatccaggggggcctagagtggctgaaa
gagcggctcttccgtgtgggtgaggactggtacttcctggtggctctcggggtgctcatg
gctctgatcagctatgctatgaacttcactattgggcgcgtggtcagagcacacaagtgg
ctgtacagggagattggagatggccacctgctccggtacctctcctggaccgtgtacccc
gtggctcttctgtccttctcctccggcttctcacagagcatcacaccatcctctggaggg
tctggaatccctgaggtgaagaccatcttgaccggagtggtcctggaggactacctagac
atcaagaacttcggggccaaggtggtgggcctctcctgcaccctggccacaggcagtacc
atcttcctgggaaaattgggtcccttcgtgcacctgagcgtgatgatcgctgcttacctg
ggccgcgtgcgcaccaagaccgtcggggaacctgagagcaagaccaaagaaatggaactg
ttggccgcaggagcagcagtgggtgtggccacggtcttcgcagctcccatcagcggtgtc
ctgttcagcatcgaggtcatgtcctctcacttctccgtctgggattactggaggggcttc
ttcgctgccacctgtggggcctttatgttccacctcctggcagtcttcaacaatgaacag
gagaccatcacctccatctacaagaccagctttccagtggacataccctttgacttacca
gagatcttcttttttgtggccctgggggccatctgtggcatcctgagctgcgggtacaac
tacagccagcggactttcttatttttcctcaaggccaatgggttcacctccaaactgctg
gctaccagcaaacccttgtactcagccctggctgctgtggtcctggcttccatcacgtat
ccccctggtgtgggccacttcatggcttcccggctgtccatgtcggagcatttggagaca
ctgtttgacaacaactcctgggcactgatgactaagaactcgtctccaccctgggcagcg
gagcctgatccccagaagctgtggttggagtggtgtcacccacagttgactgtctttggg
acactagtcttcttcctggtcatgaagttctggatgctgattttggcaaccaccatcccc
atccctgctggatacttcttgcccatctttatctatggagctgtcattgggcgcctcttt
ggggaggttctatctgtcgccttcccagagggcattgtggctggaggcagggtcaatccc
atcatgcccggggcctatgctctggcaggtgctgctgccttctcaggggcggtgacccac
accctctccacggcactgctggcctttgaggtaacgggccagctcgttcacgcactgcct
gtgctgatggctgtgctggcggccaacgccatctctcagagcttccagccctctttctac
gatggcaccatcattgtcaagaaactgccgtacctgccgtggatccgtggccgacagatt
ggttcccactctgtaactgtgggtcacttcatgaactgcgccctcactacactggccaag
gacatgcccctggagcaagtgatccaagtcgtgatctccacagatgtgacccagtacccc
ctggtggagactacagagtctcagaccctggtgggcgttgtaaaaaggacccacttggtg
caagccctccagactgagccagcttcctgggctccaggccagcagccctgtctccaggat
atcttggctaatggctgccccacccagccagtgacactgcagctgtccctggagacctcc
ttgcatgagacacacaacctttttgagctgctgaaccttcagacgctgttcgtgacgtca
cgaggcagagctgtgggctctgtatcgtgggtggagctgaagaaagcaatttcaaccctg
accaatcctcctgcccccaagtga

DBGET integrated database retrieval system