KEGG   Mus musculus (mouse): 56374
Entry
56374             CDS       T01002                                 

Gene name
Tmem59, 1110001M20Rik, 3110046P06Rik, AI256529, D4Ertd20, D4Ertd20e, MTDCF1, ORF18
Definition
(RefSeq) transmembrane protein 59
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: BSMAP Ca_hom_mod
Other DBs
NCBI-GeneID: 56374
NCBI-ProteinID: NP_083841
MGI: 1929278
Ensembl: ENSMUSG00000028618
Vega: OTTMUSG00000008472
UniProt: Q9QY73
Position
4 C7; 4 50.12 cM
AA seq 323 aa
MAAPKGKLWVQAQLGLPPLLLLTMALAGGSGTAAAEAFDSVLGDTASCHRACQLTYPLHT
YPKEEELYACQRGCRLFSICQFVDDGLDLNRTKLECESACTEAYSQPDEQYACHLGCQDQ
LPFAELRQEQLMSLMPRMHLLFPLTLVRSFWSDMMDSAQSFITSSWTFYLQADDGKIVIF
QSKPEIQYAPQLEQEPTNLRESSLSKMSYLQMRNSQAHRNYLEEEESDGFLRCLSLNSGW
ILTTTLVLSVMVLLWICCAAVATAVEQYVPPEKLSIYGDLEFMNEQKLSRYPAPSLVIVR
SQTEEHEEAGPLPTKVNLAHSEI
NT seq 972 nt   +upstreamnt  +downstreamnt
atggcggcgccaaaggggaagctttgggtccaggcccaactggggctcccgccgctgctg
ctgttgactatggcgctggccggaggctcggggactgcagcggccgaagcctttgactcg
gtcctgggagacacagcgtcctgtcaccgggcctgtcagctgacctaccccttgcacacc
tacccgaaggaagaggagttatacgcatgccagagaggctgcaggctgttttcaatttgc
cagtttgtggatgatgggcttgatttaaatcggaccaagctggaatgtgaatctgcgtgc
acagaagcatattcccaacctgatgagcagtatgcttgtcatcttggctgccaggatcag
ttgccatttgctgaactgagacaagaacaactcatgtccctgatgccaagaatgcatctc
ctcttccctctgactctggtgaggtcgttctggagtgacatgatggactctgcacagagc
ttcataacctcttcatggactttttatcttcaagccgatgacggaaaaatagttatattc
cagtctaagccagaaattcagtatgcaccgcagttggagcaggagcctacaaacttgaga
gaatcatctttaagcaaaatgtcctatctgcagatgagaaactcacaagcacacaggaac
taccttgaagaggaagaaagcgatggctttttaagatgtctatctcttaactctggatgg
attttaaccacaacccttgtcctctcggtgatggtgttgctctggatctgttgtgcagct
gttgctacagctgtagaacagtatgttccccctgagaagctgagtatctatggtgacttg
gaatttatgaatgaacaaaagctgagcagatacccagctccttctcttgtgattgttagg
tctcagactgaagaacatgaggaggcagggcccctgcccaccaaggtgaaccttgctcac
tcagaaatctaa

DBGET integrated database retrieval system