KEGG   Mus musculus (mouse): 56379
Entry
56379             CDS       T01002                                 

Gene name
Kcnj1, Kir1, Kir1.1, RO, ROMK, Romk2
Definition
(RefSeq) potassium inwardly-rectifying channel, subfamily J, member 1
  KO
K04995  potassium inwardly-rectifying channel subfamily J member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04960  Aldosterone-regulated sodium reabsorption
mmu04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    56379 (Kcnj1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    56379 (Kcnj1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    56379 (Kcnj1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   56379 (Kcnj1)
SSDB
Motif
Pfam: IRK_C IRK
Other DBs
NCBI-GeneID: 56379
NCBI-ProteinID: NP_062633
MGI: 1927248
Ensembl: ENSMUSG00000041248
Vega: OTTMUSG00000062897
UniProt: O88335
Position
9; 9 A4
AA seq 372 aa
MFKHLRRWFVTHIFGRSRQRARLVSKDGRCNIEFGNVDAQSRFIFFVDIWTTVLDLKWRY
KMTVFITAFLGSWFLFGLLWYVVAYVHKDLPEFYPPDNRTPCVENINGMTSAFLFSLETQ
VTIGYGFRFVTEQCATAIFLLIFQSILGVIINSFMCGAILAKISRPKKRAKTITFSKNAV
ISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTITPEGETIILDQTNINFVVDAGNEN
LFFISPLTIYHIIDHNSPFFHMAAETLSQQDFELVVFLDGTVESTSATCQVRTSYIPEEV
LWGYRFVPIVSKTKEGKYRVDFHNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFV
LSEVDETDDTQM
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgttcaaacatcttcgaagatggtttgtcactcacatatttgggcgttctcggcaacga
gcaaggttggtctccaaagatggaaggtgtaacatcgagtttggcaatgtagatgcacag
tcgaggtttatattctttgtggatatctggacaactgtacttgacctgaaatggaggtac
aaaatgaccgtgttcatcacagccttcttggggagttggtttctctttggtctcctgtgg
tatgtcgtagcctatgttcataaggatctcccagagttctacccacctgacaaccgtact
ccttgtgtggagaacattaatggcatgacatcagcctttctgttttctctagagacccaa
gtgaccataggttacggattcaggtttgtgacagaacagtgtgccactgccatttttctg
cttatcttccagtctattcttggagtgatcatcaattctttcatgtgtggtgccatatta
gccaagatctctagacccaaaaaacgtgcaaagaccattacattcagcaagaatgcggtg
atcagcaaacgtggggggaagctctgtctcctcatccgagtagcaaatcttaggaaaagc
cttctgattggcagtcacatatatggtaagcttctgaagactaccatcacacctgaagga
gagaccattattttggatcagaccaatataaactttgtagttgatgctggcaatgaaaat
ttgttcttcatttccccactgacaatctaccacattattgaccacaacagccctttcttc
cacatggcggcagaaactctttcccaacaggacttcgagttggttgtctttttagatggc
acagtagaatccaccagtgcaacctgccaagtccgcacatcatacatcccagaagaggtg
ctttggggttaccgttttgttcccatcgtatccaagaccaaggaagggaaataccgagtg
gatttccataactttggtaagacggtggaagtggagacccctcattgtgccatgtgcctc
tataatgagaaagatgccagggccaggatgaagagaggctatgacaaccctaactttgtc
ttgtcagaagttgatgaaacagacgacacccaaatgtag

DBGET integrated database retrieval system