KEGG   Mus musculus (mouse): 56382Help
Entry
56382             CDS       T01002                                 

Gene name
Rab9, 2410064E05Rik, AI195561, Rab9a, Sid6061p
Definition
(RefSeq) RAB9, member RAS oncogene family
  KO
K07899  Ras-related protein Rab-9A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05132  Salmonella infection
mmu05162  Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    56382 (Rab9)
  09172 Infectious disease: viral
   05162 Measles
    56382 (Rab9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    56382 (Rab9)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    56382 (Rab9)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    56382 (Rab9)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    56382 (Rab9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA ATP_bind_1 AAA_16 AAA_7 G-alpha GTP_EFTU AAA_22 AIG1
Motif
Other DBs
NCBI-GeneID: 56382
NCBI-ProteinID: NP_062747
MGI: 1890695
Ensembl: ENSMUSG00000079316
Vega: OTTMUSG00000019544
UniProt: Q9R0M6 Q0PD48
Structure
PDB: 

Position
X; X F5
AA seq 201 aa AA seqDB search
MAGKSSLFKIILLGDGGVGKSSLMNRYVTNKFDSQLFHTIGVEFLNKDLEVDGHFVTMQI
WDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFV
ILGNKTDIKERQVSTEEAQAWCKDNGDYPYFETSAKDSTNVAAAFEEAVRRILATEDRSE
HLIQTDTVNLHRKPKPNSSCC
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaaatcgtctctttttaaaataattcttcttggagatggtggagttggcaag
agttctcttatgaacagatatgtaaccaataaatttgattcccagctcttccacacaata
ggtgtggaatttttaaataaagatctggaggtggacggacattttgttaccatgcagatt
tgggacacagctggccaagaacgcttccgaagcctgaggacgccattttaccggggttct
gactgttgcctgcttacatttagtgtcgatgattcacagagcttccagaatttgagcaac
tggaagaaagagttcatatattacgcagatgtgaaagagcctgaaagctttccctttgtg
attttgggcaacaagactgacataaaagaacggcaggtgtctacagaagaagcccaagcc
tggtgcaaggacaacggcgactatccttactttgaaacaagtgcaaaagattccaccaat
gttgctgctgcctttgaggaggcagttcgaagaattctggccacggaagataggtcagaa
cacctgattcagacagacacagtcaatctgcaccgaaagcccaagccaaactcatcttgc
tgttga

DBGET integrated database retrieval system