KEGG   Mus musculus (mouse): 56384
Entry
56384             CDS       T01002                                 

Gene name
Letm1
Definition
(RefSeq) leucine zipper-EF-hand containing transmembrane protein 1
  KO
K17800  LETM1 and EF-hand domain-containing protein 1, mitochondrial
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    56384 (Letm1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    56384 (Letm1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Other inner membrane factors
    56384 (Letm1)
Transporters [BR:mmu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   56384 (Letm1)
SSDB
Motif
Pfam: LETM1 EF-hand_6 DUF4335 SAP Acetyltransf_11
Other DBs
NCBI-GeneID: 56384
NCBI-ProteinID: NP_062668
MGI: 1932557
Ensembl: ENSMUSG00000005299
Vega: OTTMUSG00000021523
UniProt: Q9Z2I0
Position
5; 5 B2
AA seq 738 aa
MASILLRSCRGRGPARLAPPRAASPRGSLRDRACLSCTRTLGLTSRESVLSRCCTPAHPV
YLCFKGEPLSCWTQRPECQGTAARTTWTPASARLVVTGPQYLPVRGWHSSSPLGEDSVIE
KSLKSLKDKNKKLEEGGPVYSPPAQVVVRKSLGQKVLDELRHYYHGFRLLWIDTKIAARM
LWRILNGHTLTRRERRQFLRICADLFRLVPFLVFVVVPFMEFLLPVVVKLFPNMLPSTFE
TQSIKEERLKKELRVKLELAKFLQDTIEEMALKNKAAKGNATKDFSAFFQKIRETGERPS
NEEIMRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRSIKADDKL
ISEEGVDSLTVKELQAACRARGMRALGVTEDRLKGQLKQWLDLHLHHEIPTSLLILSRAM
YLPDTLSPADQLKSTLQTLPEIVAKEAQVKVAEVEGEKVDNKAKLEATLQEEAAIQQEHL
EELKRASEAVKDIQPEVAEATLPGRPGPEPQPPVDDVILPSEVLTDTAPVLEGLKGEEIT
KEEIDILSDACSKLQEQKKSLTKEKEELELLKEDVQDYSEDLQEIKKELSKTGEEKYIEE
SAASKRLSKRVQQMIGQIDGLITQLETTQQDGKLGPSQSTPTGESVISITELISAMKQIK
HIPEHKLISLTSALDDNKDGNINIDDLVKVIDLVNKEDVQISTTQVAEIVATLEKEEKIE
EKEKAKEKAEKEAAEVKN
NT seq 2217 nt   +upstreamnt  +downstreamnt
atggcgtccatcttgctcaggagctgccggggccgggggcctgcccgcctcgcgccacct
cgggccgcctccccgcggggtagtctgagggatcgagcttgtctcagctgtaccaggacc
ctggggttgacgagccgtgagagtgttctgtctcgttgctgtactccagcccaccctgtg
tacctctgcttcaaaggtgagcccctcagctgttggactcagaggcctgagtgccagggc
accgcagcaagaacaacatggacacctgcctctgcaaggctggtggttacgggacctcag
taccttcctgtgcgcggctggcactcatcatctccgctaggagaggactctgtgatagag
aagtcccttaagtccttaaaagacaagaataagaagctggaggagggcggccccgtgtac
agcccgcccgcgcaggtggtggtgaggaaatccctcgggcagaaggtactggatgagctg
aggcactactaccatggcttccgcctgctctggatcgacaccaagatcgctgcccggatg
ctctggcgcatcctcaatggccatacgctgacccgccgggagcgcaggcagtttctccgg
atttgtgcggacctcttccgtctagtgcccttcctggtgttcgtggtggtgcccttcatg
gaattcctgctgcctgtagttgtgaagctcttccccaacatgctgccctctacatttgag
acccagtctatcaaggaggaaaggctgaagaaggagctgagggtgaagctggagctggcc
aagtttctccaggacaccatagaggaaatggccctgaagaacaaggcagccaaagggaat
gccaccaaagatttctctgcatttttccagaagatccgggagacaggggagagacccagc
aatgaggaaatcatgcgtttttccaaactgtttgaggatgaactgaccctggataacctc
acgaggcctcagctggtagcactgtgcaagctgctggagcttcagtccattggcaccaac
aacttcctgcgtttccagctcaccatgcgcctgaggtccataaaggctgatgataagctg
atttctgaggaaggggtggacagtctgactgtaaaagaattgcaggcagcatgtcgagca
cggggcatgagagctctcggtgtcacagaagaccgtctgaagggccagctgaaacagtgg
ctggacttgcacctgcatcacgagatccccacatcattgctcatactgtcccgggccatg
tacctcccagacaccctctcacctgctgaccagctgaagtccaccttgcagacccttcca
gaaattgtggcaaaggaggcccaggtgaaagtggccgaggtggagggcgaaaaggtagac
aacaaggcgaagctggaggccacactgcaggaagaggccgccatccagcaagaacacctg
gaagaactaaagagagcctctgaggctgtgaaggacatccagccagaagtagcggaagcc
actctccctgggaggccagggcctgagcctcagcctccagtggatgatgtgatcctgccc
tcagaggtcctgacggatacggcacctgtactggaaggtctgaagggtgaagagattacc
aaggaggagattgacatcctcagtgacgcctgctccaagctgcaggagcagaagaagtcc
ctgaccaaggagaaggaggagctggagctgctcaaagaggacgtccaggactacagtgag
gacttacaggagatcaagaaggaactttcaaagacgggtgaggagaagtacatagaagaa
tctgcagcgagcaagaggctgtcaaagcgagtgcagcagatgatcgggcagatcgatggc
ctgatcacacagctggagaccactcaacaggatggcaagctgggccccagccagagcact
ccaacaggggagagtgtcatcagcatcactgagctcatcagcgccatgaagcaaatcaag
cacattccagagcacaagctcatcagtttgacctcagccctggatgataataaggacggc
aatatcaacatcgatgaccttgtcaaggtaatcgacttggtgaacaaagaagatgttcag
atctctaccacccaggtagctgaaattgtggccacactagagaaagaagaaaagatagaa
gagaaagagaaggccaaggagaaggctgagaaagaggccgcagaagtgaagaattag

DBGET integrated database retrieval system