KEGG   Mus musculus (mouse): 56389
Entry
56389             CDS       T01002                                 

Gene name
Stx5a, 0610031F24Rik, D19Ertd627e, Stx5
Definition
(RefSeq) syntaxin 5A
  KO
K08490  syntaxin 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    56389 (Stx5a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    56389 (Stx5a)
Membrane trafficking [BR:mmu04131]
 SNARE
  Syntaxin (Qa)
   Stx-cisGolgi
    56389 (Stx5a)
SSDB
Motif
Pfam: SNARE Syntaxin-5_N Syntaxin Apolipoprotein DUF16 Vac_Fusion UPF0242 SKA1 MCPsignal DUF5063 DUF1664 DUF5082
Other DBs
NCBI-GeneID: 56389
NCBI-ProteinID: NP_001161271
MGI: 1928483
Ensembl: ENSMUSG00000010110
Vega: OTTMUSG00000039850
UniProt: Q8K1E0
Position
19; 19 A
AA seq 355 aa
MIPRKRYGSKNTDQGVYLGLSKTQVLSPATAISSSSDSTPLPTPVALVPSPPDTMSCRDR
TQEFQSACKSLQSRQNGIQTSKPALHAARQCSEFTLMARRIGKDLSNTFAKLEKLTILAK
RKSLFDDKAVEIEELTYIIKQDINSLNKQIAQLQDFVRAKGSQSGRHLQTHSNTIVVSLQ
SKLASMSNDFKSVLEVRTENLKQQRNRREQFSRAPVSALPLAPNNLGGGPIILGAESRAS
RDVAIDMMDPRTSQQLQLIDEQDSYIQSRADTMQNIESTIVELGSIFQQLAHMVKEQEET
IQRIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIFVVFLA
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgatcccgcggaaacgctacggatctaagaacacggatcagggtgtctacctgggtctc
tcaaagacacaggttctgtcccctgcaactgctatcagtagcagcagtgacagcactcct
ttgcccactccggtggccctggtcccctcccctcccgacaccatgtcctgccgggatcgg
acccaggagttccagtctgcctgcaagtccctgcagagccgtcagaatggaatccaaaca
agcaaaccggctctgcacgcagcccgacagtgcagtgaatttaccctcatggccaggcgc
attgggaaagatctcagcaatacatttgccaagctggagaagctaacaatcttggcaaag
cgcaagtccctctttgatgataaagcagtagaaattgaggagctaacatacatcatcaaa
caggatatcaatagcctcaacaaacaaattgctcagcttcaagattttgtgagggccaag
ggcagccagagtggccggcatctgcagacccattctaacaccattgtggtttcgttgcag
tcaaagctggcttctatgtccaatgacttcaagtcagttctagaagtgaggactgagaat
ctgaaacagcagaggaaccgtcgggaacagttctccagggcaccagtgtcagccctgcct
cttgcccccaacaaccttggaggtggtcccataattttgggagcagagtcccgagcttcc
agggacgtggctattgacatgatggaccctagaacaagccagcagcttcagctcattgat
gagcaggattcctacatccagagtcgggcagacaccatgcagaacattgagtctacaatc
gttgagctgggctccatttttcagcaattggcacacatggttaaagaacaggaggaaacg
attcagaggatcgacgagaatgtgcttggagcccagctggatgtggaggcagcccattca
gagatcctcaagtacttccagtcagttacctccaatcggtggctcatggtcaaaatcttc
ctcatcctcattgtcttcttcatcatctttgtggtcttccttgcctga

DBGET integrated database retrieval system