KEGG   Mus musculus (mouse): 56390Help
Entry
56390             CDS       T01002                                 

Gene name
Znrd2, 1500016H19Rik, C184L, Sssca1
Definition
(RefSeq) zinc ribbon domain containing 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Auto_anti-p27 OrfB_Zn_ribbon
Motif
Other DBs
NCBI-GeneID: 56390
NCBI-ProteinID: NP_065237
MGI: 1913482
Ensembl: ENSMUSG00000079478
Vega: OTTMUSG00000035065
UniProt: P56873 Q545N1 Q9D002
Position
19; 19 A
AA seq 199 aa AA seqDB search
MALNGADVDDFTWEPPTEAETKVLQARRERQDRISRLMGDYLLRGYRMLGDTCADCGTIL
LQDKQRKIYCVACQELDSDVDKDNPALNAQAALSQAREHQLASSTEPASSSRPPSQPPVP
RPEHCEGAAAGLKAAQAPPLPAAPPNTDAVASTQTALLQKLTWASVELGSSTSLETSIQL
CGLIRACAEALGSLKQLDH
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccttgaacggtgcagatgtcgacgatttcacctgggagcctccgactgaagctgag
acgaaggtgctgcaggcgcgacgggagcggcaggatcgcatctcccgtctgatgggggac
tacctgctccgtggttaccgcatgctgggcgacacgtgcgccgactgcgggacgatcctc
ctgcaagataaacagcggaaaatctactgtgtggcttgtcaggagctcgactcagacgtg
gataaagataacccggcactgaatgcacaggcggcgctctctcaagctcgggaacaccag
ctggcctcatctacagagcctgcctcgagctctcggcccccatcccagccaccagtaccc
cgtccagagcactgtgaaggcgcagcagccgggctcaaggcagcccaggcgcctcctctt
ccggctgcacctccaaatacggacgcggtggcttccacacagacggccctcctgcagaag
ctaacctgggcgtcagtcgagctgggctctagcacctccttggagactagtatccagctc
tgtgggcttatccgggcttgcgccgaggccctaggcagcctgaaacagctggatcactga

DBGET integrated database retrieval system