KEGG   Mus musculus (mouse): 56392
Entry
56392             CDS       T01002                                 

Gene name
Shoc2, AU017287, Sur8, mKIAA0862
Definition
(RefSeq) Shoc2, leucine rich repeat scaffold protein
  KO
K19613  leucine-rich repeat protein SHOC2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    56392 (Shoc2)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_9 LRR_5
Other DBs
NCBI-GeneID: 56392
NCBI-ProteinID: NP_001161977
MGI: 1927197
Ensembl: ENSMUSG00000024976
UniProt: O88520
Position
19; 19 D2
AA seq 582 aa
MSSSLGKEKDSKEKDPKVPSAKEREKESKASGGFGKESKEKEPKAKGKDAKDGKKESSAA
QPGVAFSVDNTIKRPNPAPGTRKKSSNAEVIKELNKCREENSMRLDLSKRSIHILPPSVK
ELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNK
LREIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLPKLSMLSIRENKIKQLPAEIGELCNL
ITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPDTIGNLSSLNRLGLRYNRLSAIP
RSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSL
NMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPED
VSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTN
NQLSTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALC
SKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLKMQGPYRAMV
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgagtagtagtttaggaaaagaaaaagactctaaagagaaagaccccaaagtaccgtct
gccaaggaaagagaaaaggagtcaaaagcctcaggaggctttgggaaagagagcaaagaa
aaggaacctaaagccaaagggaaagacgccaaagatggaaagaaggagtccagcgctgcc
cagccaggtgtggctttttcagtcgacaataccatcaaacggccaaatccagcacccggc
actagaaaaaagtccagcaatgctgaggtcattaaggagcttaacaaatgccgggaggag
aactcaatgcggttggacttgtccaagaggtctatacatatactgccaccatcagtcaaa
gagttgactcaactcacagaactttatttatacagtaacaaattgcagtccctcccagca
gaggtgggctgtctagtcaatctcatgacgctggctctcagtgagaattcactcaccagt
ttgcctgactctcttgataacttgaagaagctgcggatgcttgatttacggcataataaa
ctgagagaaattccttcagtggtgtataggctagactctctcaccactctctatcttcgc
tttaatcgcataactactgtggaaaaggacatcaaaaacctgccgaagctcagcatgctc
agcatccgagagaacaaaatcaagcagctgcctgctgaaattggtgaattatgtaacctc
attaccctggatgtagctcacaatcaacttgaacaccttccaaaggagattggaaactgc
acacagataaccaaccttgacttgcagcacaatgacctactggacctcccagatacaata
ggaaacctgtccagtttaaatcgccttggcctgagatacaatagattgtcagcaataccc
agatcattagcaaaatgcagtgcacttgaggagttaaatttagagaacaataacatttct
actctaccagagagtcttttatccagtcttgtaaaattgaatagcttgaccttagctaga
aattgcttccagttatatccagtgggaggtccatctcagttttccaccatttattccctc
aacatggaacacaatcgaatcaacaaaatcccatttggaattttttccagagctaaagtg
ttaagtaagctgaatatgaaggacaatcagttaacatcacttcctttggattttggaact
tggaccagtatggtagaattgaatttagcgactaatcagctcacaaagatcccagaggat
gtgtctggtctcgtttcccttgaggttctgatcttatcgaacaaccttctaaagaagctg
ccccacggccttgggaacctcagaaagctacgagagctggacctggaggagaacaagctg
gagtccttgcccaatgagatcgcgtatctcaaggatctgcagaaattagtcttgacaaac
aaccagttgagcacgcttcccagaggcatcggtcaccttaccaacctcacgcaccttggt
cttggagagaacctgctcactcaccttcctgaggaaatcggtacactggaaaacctagaa
gaactgtatttgaacgacaaccccaaccttcacagcctcccctttgagcttgctctctgc
agcaagctgtcaatcatgagtattgagaactgtccactcagtcacctcccacctcaaatt
gttgctggagggccttcgttcattattcagttcttaaagatgcagggtccatatcgtgcc
atggtctga

DBGET integrated database retrieval system