KEGG   Mus musculus (mouse): 56398Help
Entry
56398             CDS       T01002                                 

Gene name
Chp1, 1500003O03Rik, AA960066, AI046351, Cahp, Chp, Sid470p, p24, vac
Definition
(RefSeq) calcineurin-like EF hand protein 1
  KO
K17610  calcineurin B homologous protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    56398 (Chp1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     56398 (Chp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 SPARC_Ca_bdg RST
Motif
Other DBs
NCBI-GeneID: 56398
NCBI-ProteinID: NP_062743
MGI: 1927185
Ensembl: ENSMUSG00000014077
Vega: OTTMUSG00000015945
UniProt: P61022
Position
2; 2 E5
AA seq 195 aa AA seqDB search
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFSEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggggtctcgggcctccacgttattgcgggacgaagagctcgaggagatcaagaaggag
actggcttttcccacagtcagatcacgcgcctgtacagccgcttcaccagcctggacaaa
ggggagaacgggactctcagccgggaagatttccagaggattccagaacttgccatcaac
ccactgggggaccggatcatcaatgccttcttctcagagggagaggatcaggtaaacttc
cgaggattcatgagaacattggctcatttccgacccattgaggataacgaaaagagcaaa
gatgtgaatggcccggaacccctcaacagccggagcaacaagctgcactttgctttcaga
ctctatgatttggataaagatgacaagatctcccgtgatgagctgttacaggtactgcga
atgatggttggagtgaatatctcggatgagcagctgggcagtattgcggacaggaccatc
caggaggctgaccaagatggagatagtgccatatcttttacagaattcgttaaggttttg
gaaaaagtggatgtagaacagaagatgagcatccgatttcttcactaa

DBGET integrated database retrieval system