KEGG   Mus musculus (mouse): 56399
Entry
56399             CDS       T01002                                 

Gene name
Akap8, 1200016A02Rik, AA673585, AKA, AKAP-8, AKAP95, AU015639
Definition
(RefSeq) A kinase (PRKA) anchor protein 8
  KO
K16525  A-kinase anchor protein 8
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    56399 (Akap8)
SSDB
Motif
Pfam: AKAP95 zf-C2H2_2
Other DBs
NCBI-GeneID: 56399
NCBI-ProteinID: NP_062748
MGI: 1928488
Ensembl: ENSMUSG00000024045
UniProt: Q9DBR0 Q059U9
Position
17; 17 B1
AA seq 687 aa
MEQGYGGYGAWSAGPANTQGTYGSGMTSWQGYENYNYYNAQNTSVPAGTPYSYGPASWEA
TKTNDGGLAAGSPAMHVASFAPEPCTDNSDSLIAKINQRLDMLSKEGGRGGISSGGEGVQ
DRDSSFRFQPYESYDARPCIPEHNPYRPGYGYDYDFDLGTDRNGSFGGTFNDCRDPAPER
GSLDGFLRGRGQGRFQDRSNSSTFIRSDPFMPPSASEPLSTTWNELNYMGGRGLGGPSTS
RPPPSLFSQSMAPDYSMMGMQGVGGFGGTMPYGCGRSQTRIRDWPRRRGFERFGPDNMGR
KRKQFPLYEEPDAKLARADSDGDLSENDDGAGDLRSGDEEFRGEDDLCDSRKQRGEKEDE
DEDVKKRREKQRRRDRMRDRAADRIQFACSVCKFRSFEDEEIQKHLQSKFHKETLRFIST
KLPDKTVEFLQEYIINRNKKIEKRRQELLEKESPKPKPDPFKGIGQEHFFKKIEAAHCLA
CDMLIPAQHQLLQRHLHSVDHNHNRRLAAEQFKKTSLHVAKSVLNNKHIVKMLEKYLKGE
DPFVNETADLETEGDENVGEEKEETPEEVAAEVLAEVITAAVKAVEGEGEPAAAHSDVLT
EVEGPVDTAEASSDPHTEKLLEEQTCEAASETRSIEDKTRGEAAEARNEAAMPTADAGST
LPVIAIPGIMEDELEQTGAEAKDIPTE
NT seq 2064 nt   +upstreamnt  +downstreamnt
atggagcaaggctacggaggctatggggcatggagtgctggacctgccaacacccagggt
acatatggaagtggtatgaccagctggcaaggttatgaaaactacaactactacaatgcc
cagaacaccagtgtccctgcaggaacaccctatagttacggcccagcctcatgggaggcc
accaagaccaatgatggtggcctggcagctgggagccctgccatgcatgtggcgtctttt
gccccagagccatgtaccgacaactcagactcgctcattgccaagatcaatcaacgtttg
gacatgttgtctaaggaaggaggcaggggtgggatcagcagcggtggggagggcgtgcag
gaccgagacagctccttccgcttccagccatacgagtcctacgacgccaggccctgtata
cctgagcataatccctaccgccccggctacggttatgattatgactttgacttgggaact
gaccgcaatggtagctttggtgggacattcaacgactgtcgggacccagccccagagcgg
ggctcccttgatggtttcttgaggggccggggccagggccgcttccaagaccggagcaac
tccagcaccttcatacgtagtgaccctttcatgccaccctcagcctcggagcccttatcc
actacgtggaatgagctgaactacatgggtggccgtggtctcggtgggccctccaccagc
aggccacctccttccctcttctcccagtccatggcccctgactacagcatgatgggcatg
cagggggtgggcggttttggtggtaccatgccttacggatgtggccggtcccagacgcgg
atacgggattggcctagaaggagggggtttgaacgctttggaccagacaacatgggcagg
aagcggaagcagtttccattgtatgaagaacctgatgccaaactggcccgtgctgacagt
gacggagatctgtctgaaaacgatgatggagctggtgacttaagatcaggagatgaagaa
ttcaggggggaggatgacttgtgtgactccaggaagcagagaggagaaaaggaggacgag
gatgaggatgtgaagaagagacgggagaaacaaaggaggagagacaggatgcgggaccga
gcagctgacaggattcagtttgcctgttctgtatgcaagtttcgtagctttgaagatgaa
gaaattcaaaagcatctgcaaagtaaatttcacaaagagactttgcgatttataagtacc
aaactgcccgacaagacagtagaattcctccaggagtacatcataaacaggaataagaaa
attgagaaacggcgtcaggagttgttggagaaggagagccctaaacccaaaccagatcca
ttcaaaggcattggccaggagcatttcttcaaaaagattgaagccgcacattgcctagcc
tgtgacatgctgattcctgcgcagcatcagcttctccagcggcatctgcattccgtggac
cataaccataatcgaaggttggctgctgagcagttcaagaaaacaagtctccatgtggct
aagagtgttttgaacaacaaacatatagtgaagatgctggaaaaatacctcaagggtgag
gatccttttgtcaatgaaactgctgaccttgagacagaaggagatgaaaatgtaggagag
gagaaggaggagacaccagaggaggtagctgccgaagtcttagcagaggtgatcacagca
gcagtgaaggctgtagagggggaaggagaacctgctgcagcgcatagtgacgtcctaact
gaagtggaagggcctgtggacacagcagaggccagcagtgacccccacactgaaaagcta
ctagaagagcagacctgtgaagcagcatctgaaaccaggagcatcgaagacaagaccaga
ggtgaggctgctgaggccagaaacgaagcagctatgccaacagcagacgcaggaagcacg
ttacctgtcatagcaatcccgggaatcatggaagatgagctggaacaaactggtgcagag
gccaaagatattcccaccgaatga

DBGET integrated database retrieval system