KEGG   Mus musculus (mouse): 56417
Entry
56417             CDS       T01002                                 

Gene name
Adar, AV242451, Adar1, Adar1p110, Adar1p150, DRADA, mZaADAR
Definition
(RefSeq) adenosine deaminase, RNA-specific
  KO
K12968  double-stranded RNA-specific adenosine deaminase [EC:3.5.4.37]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu05162  Measles
mmu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    56417 (Adar)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    56417 (Adar)
   05164 Influenza A
    56417 (Adar)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    56417 (Adar)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.37  double-stranded RNA adenine deaminase
     56417 (Adar)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    56417 (Adar)
SSDB
Motif
Pfam: A_deamin z-alpha dsrm DND1_DSRM TrmB RPA_C
Other DBs
NCBI-GeneID: 56417
NCBI-ProteinID: NP_001139768
MGI: 1889575
Ensembl: ENSMUSG00000027951
Vega: OTTMUSG00000020280
UniProt: Q99MU3 Q3UH31
Position
3; 3 F1
AA seq 1178 aa
MSQGFRGPTGVFPHQTQSYLDPSHEHSKWRYPQPQGPESYPRSFQLQQIEFLKGRLPEAP
LIGIQTQSLPPFLPGHWPRFPGPPAQDRQLEIWEFPRSVTLRNQGFHIGPPLPPPHSRGT
PWRGADGLCSHFRELSISQSPEQKVLNRLEELGEGKATTAHVLARELRIPKRDINRILYS
LEKKGKLHRGRGKPPLWSLVPLSQAWTQPPGVVNPDSCIQEFPRGEPGLDSEDGDPASDL
EGPSEPLDMAEIKEKICDYLFNVSNSSALNLAKNIGLTKARDVTSVLIDLERQGDVYRQG
ATPPIWYLTDKKRERLQMKRSTHSAPAPTPTAVPEATRSPSFPACHPPPAGASSSVAASK
RVENGQEPAIKHESRHEARPGPMRLRPHAYHNGPSRAGYVASENGQWATDDIPDNLNSIH
TAPGEFRAIMEMPSFYSPTLPRCSPYKKLTECQLKNPVSGLLEYAQFTSQTCDFNLIEQS
GPSHEPRFKFQVVINGREFPPAEAGSKKVAKQDAAVKAMAILLREAKAKDSGQPEDLSHC
PMEEDSEKPAEAQAPSSSATSLFSGKSPVTTLLECMHKLGNSCEFRLLSKEGPAHDPKFQ
YCVAVGAQTFPPVSAPSKKVAKQMAAEEAMKALQEEAASSADDQSGGANTDSLDESMAPN
KIRRIGELVRYLNTNPVGGLLEYARSHGFAAEFKLIDQSGPPHEPKFVYQAKVGGRWFPA
VCAHSKKQGKQDAADAALRVLIGESEKAEQLGFAEVTPVTGASLRRTMLLLSRSPDAHPK
TLPLSGSTFHDQIAMLSHRCFNALTNSFQPSLLGRKILAAIIMKRDPEDMGVVVSLGTGN
RCVKGDSLSLKGETVNDCHAEIISRRGFIRFLYSELMKYNHHTAKNSIFELARGGEKLQI
KKTVSFHLYISTAPCGDGALFDKSCSDRAVESTESRHYPVFENPKQGKLRTKVENGEGTI
PVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQGALLTHFLQPVYLKSVTLGYLF
SQGHLTRAICCRVTRDGKAFEDGLRYPFIVNHPKVGRVSVYDSKRQSGKTKETSVNWCMA
DGYDLEILDGTRGTVDGPGKELSRVSKKNIFLQFKKLCSFRARRDLLQLSYGEAKKAARD
YDLAKNYFKKSLRDMGYGNWISKPQEEKNFYLCPVPND
NT seq 3537 nt   +upstreamnt  +downstreamnt
atgtctcaagggttcaggggacccacaggggtgttccctcaccagacacagtcgtacttg
gaccctagtcatgagcatagcaagtggagatacccgcagccacaggggccggagtcttac
cctaggagtttccagcttcagcagatagagtttctcaaagggcggctcccagaagcaccc
ttgattggaatacaaacccagtcactgccgccattcctcccaggacactggccaagattc
ccagggccacctgcccaagacaggcaactggaaatctgggagttccccaggagtgtgact
ctcagaaatcaggggttccacataggacccccacttcctcccccacacagcaggggtaca
ccatggagaggtgctgacgggctttgctcacacttccgggagctgagcatcagtcagagt
ccggagcagaaggttctaaaccgcctggaagagcttggggaggggaaggccaccactgcc
catgtgctagccagagagctcagaatccccaaaagggacatcaatcgtattttgtactcc
ctggaaaagaagggaaagctgcacagaggaagggggaaacctcctttgtggagccttgtg
cccttgagtcaggcttggactcagccccctggagttgtgaatccagatagttgtatccag
gaattccctagaggagagcctggtttggacagtgaggacggagaccctgcctctgactta
gaaggaccttctgagcctcttgacatggctgaaatcaaggagaagatctgtgactatctg
ttcaatgtgtcaaactcctctgccctgaacctggctaagaacattggcctcaccaaggcc
cgagatgtgacctcagtgctgattgacttggaaaggcaaggcgatgtctacaggcaaggg
gcaactcctcccatctggtacttgacggacaagaagcgtgagaggctgcagatgaagaga
agtacacacagtgctcctgcccctaccccgacagctgtcccagaggccactagaagcccc
tcattccctgcctgccacccgcccccagcaggtgcctcaagcagtgtggcagcctccaag
agagtggagaatgggcaggagcctgcgataaagcatgaaagtaggcatgaggccagacca
ggaccaatgagactgcggcctcacgcttatcacaatggcccctctagagcagggtatgtg
gcctctgaaaatggccagtgggccacagatgacatcccagataacttgaatagtatccac
acagcaccaggtgagtttcgagccatcatggagatgccctccttctacagccctaccttg
ccacggtgttcaccctacaagaagctaactgagtgccagctgaagaaccctgtcagcggg
ttgttagagtatgctcagttcactagtcagacctgtgatttcaacctgatagagcagagt
ggaccgtcccatgaacctcgatttaaattccaggttgtcatcaatgggcgggaatttccc
ccagctgaggctggcagcaagaaagtagccaagcaggacgcagcagtgaaagccatggcg
attctgcttcgggaagccaaagccaaagacagtggtcaaccagaagacttgtcccactgt
cccatggaagaagactcggagaaaccagcagaggctcaggcccccagctcctcagcaaca
tccttgttctctgggaagagcccagttactacactgcttgagtgcatgcacaaactaggg
aactcctgtgaattccgtctcctgtccaaagaaggccctgctcatgaccccaagttccag
tactgtgtagcagtaggagcccagaccttcccccctgtgagcgcccccagcaagaaggta
gcaaagcagatggccgcagaggaagccatgaaggcgctgcaggaggaggcagccagttca
gcggatgaccagtctggaggtgcgaacacagactcacttgatgaatctatggctcccaac
aagatcaggaggattggtgagctcgtcaggtacctgaacaccaaccccgtaggcggcttg
ttggagtacgcccgatctcatggctttgctgctgagttcaagctcattgaccagtctgga
cctcctcacgaacccaagtttgtttaccaagcaaaagttgggggccgctggtttccagcc
gtgtgtgcacacagcaagaaacagggcaagcaggatgcagcggatgcagccctccgggtc
ttgatcggggagagcgagaaggcagagcagttgggtttcgcagaggtaaccccagtaaca
ggggccagtctcagaagaactatgctcctcctttccaggtccccagatgcacatccaaag
acacttcctctctctggcagcaccttccacgaccagatagctatgctgagccacaggtgc
ttcaatgctctgaccaacagtttccagccctccctgctcggccgcaagatcctggctgcc
attattatgaaaagagatccagaggacatgggtgttgtcgtgagtttggggacaggcaat
cgctgtgtgaaaggggactctctcagcctgaagggagagacggtcaatgactgccatgcc
gaaatcatctcccggaggggcttcatcaggtttctctacagtgaactgatgaagtacaac
caccacactgccaagaacagcatatttgagcttgccaggggaggagagaagctgcagata
aagaagacggtttcttttcatctctacatcagcacggcgccatgtggagatggggccctc
tttgacaaatcctgcagtgaccgtgccgtggaaagcacagagtcccgccattaccctgtc
tttgaaaatcccaagcaaggcaagcttcgcaccaaggtggagaatggggaaggcacaatt
cctgtggagtccagtgatattgtacccacgtgggatggcatccgccttggggaaagactc
cgtaccatgtcctgtagtgacaaaatcctacgctggaatgtgctgggcctgcaaggggcg
ttgttgacgcacttcctacagcctgtgtacctgaaatctgtaaccttaggttaccttttc
agccaagggcatctgacccgtgctatttgctgccgcgtgaccagagatgggaaagcattt
gaggatggactacgctatccctttattgtcaaccaccccaaggtcggccgagtcagtgtt
tatgattccaaaagacagtccggaaagaccaaggaaacaagcgtcaactggtgcatggct
gatggctatgacctagagatcctggatggcaccagaggcactgtggatggaccagggaaa
gagttgtctcgggtgtccaagaagaatattttccttcagtttaagaagctctgctccttc
cgagcccgcagagatttactgcagctctcttatggtgaagccaagaaagctgcccgtgac
tatgacttagccaagaactacttcaagaaaagcctgcgagacatgggctatgggaattgg
atcagcaaaccccaggaggaaaagaacttttacctctgtccagtacccaatgactga

DBGET integrated database retrieval system