KEGG   Mus musculus (mouse): 56418
Entry
56418             CDS       T01002                                 

Symbol
Ykt6, 0610042I15Rik, 1810013M05Rik, AW105923
Name
(RefSeq) YKT6 v-SNARE homolog (S. cerevisiae)
  KO
K08516  synaptobrevin homolog YKT6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    56418 (Ykt6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    56418 (Ykt6)
Membrane trafficking [BR:mmu04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Ykt6
    56418 (Ykt6)
SSDB
Motif
Pfam: Synaptobrevin Longin
Other DBs
NCBI-GeneID: 56418
NCBI-ProteinID: NP_062635
MGI: 1927550
Ensembl: ENSMUSG00000002741
Vega: OTTMUSG00000005103
UniProt: Q9CQW1
Position
11; 11 A1
AA seq 198 aa
MKLYSLSVLYKGDPKAVLLKAAYDVSSFSFFQRSSVQEFMTFTSQLIVERSGKGSRASVK
EQEYLCHVYVRSDSLAGVVIADSEYPSRVAFTLLEKVLDEFSKQVDRIDWPVGSPATIQY
TGLDDHLSKYQNPREADPMSKVQAELDETKIILHNTMESLLERGEKLDDLVSKSEVLGTQ
SKAFYKTARKQNSCCAIM
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaagctgtacagccttagtgtcctttacaaaggcgatccgaaagcggtgctgctcaag
gccgcgtacgacgtgtcttcctttagtttcttccagaggtccagtgtgcaggaattcatg
acctttacaagtcaactgattgtggaacgctcggggaaaggcagcagagcttctgtcaaa
gaacaagagtatctttgccatgtctacgtccggagcgacagtctggcaggtgtggtcatt
gctgacagcgaatacccttccagagtggccttcaccttgctggagaaggtactagatgaa
ttctccaagcaggtggatagaatagactggccagtaggatccccggctacaatccagtac
acaggcctggacgatcaccttagtaaataccagaacccccgagaagctgatcccatgagt
aaagtgcaggccgaactggacgagaccaaaatcattctgcacaacaccatggagtctttg
ttagagcgaggcgagaagcttgatgacctggtatccaagtcagaagtgctgggaacacag
tcgaaagccttctataaaactgcccggaaacaaaactcttgctgtgcaatcatgtga

DBGET integrated database retrieval system