KEGG   Mus musculus (mouse): 56424
Entry
56424             CDS       T01002                                 

Gene name
Stub1, 0610033N24Rik, 2210017D18Rik, 2310040B03Rik, AW046544, CH, Chip
Definition
(RefSeq) STIP1 homology and U-Box containing protein 1
  KO
K09561  STIP1 homology and U-box containing protein 1 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    56424 (Stub1)
   04120 Ubiquitin mediated proteolysis
    56424 (Stub1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    56424 (Stub1)
   04131 Membrane trafficking [BR:mmu04131]
    56424 (Stub1)
   04121 Ubiquitin system [BR:mmu04121]
    56424 (Stub1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     56424 (Stub1)
Chaperones and folding catalysts [BR:mmu03110]
 Other chaperones and cochaperones
  Others
   56424 (Stub1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    56424 (Stub1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  U-box type E3
   56424 (Stub1)
SSDB
Motif
Pfam: U-box CHIP_TPR_N TPR_1 TPR_2 ANAPC3 TPR_16 TPR_8 TPR_12 TPR_11 TPR_17 TPR_19 TPR_14 TPR_6 TPR_9 zf-NOSIP TPR_10
Other DBs
NCBI-GeneID: 56424
NCBI-ProteinID: NP_062693
MGI: 1891731
Ensembl: ENSMUSG00000039615
UniProt: Q9WUD1
Structure
PDB: 
3Q49 3Q4A 3Q47 2C2V 2C2L

Position
17 A3.3; 17 12.93 cM
AA seq 304 aa
MKGKEEKEGGARLGTGGGGSPDKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLV
AVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQR
AYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLTRLIAAERERELEE
CQRNHEGHEDDGHIRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFEL
MREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGW
VEDY
NT seq 915 nt   +upstreamnt  +downstreamnt
atgaagggcaaggaggaaaaggagggcggcgcgcggctgggcactggtggcggcggcagc
cctgataagagcccgagtgcgcaagagctcaaggagcagggaaaccggctcttcgtgggc
cgcaagtacccggaggcggcggcctgctacggccgcgccatcactcggaacccacttgtg
gcagtgtactacactaaccgggccctgtgctatctgaagatgcagcagcctgaacaggca
cttgctgactgccggcgagccctggagctggacgggcagtctgtgaaggcgcacttcttc
ctggggcagtgccagctggagatggagagttatgatgaggccattgccaatctgcagcga
gcctatagtttggccaaggagcagcgactcaactttggggatgatattcctagtgccctt
cgcattgctaagaagaagcgctggaacagtatcgaggaacggcgcatccaccaggagagt
gagctgcattcatatctcaccaggctcattgctgctgagcgagagagggaactggaggag
tgtcagcggaaccacgagggtcatgaagatgatggccacatccgggcccagcaggcctgc
attgaggccaagcacgataaatacatggcagatatggatgagctcttctctcaggtggac
gagaaaagaaagaagcgagatatccctgactacttgtgtggcaagattagctttgagctg
atgcgggaaccctgcattacacccagtggtatcacctatgaccgcaaggacattgaggag
cacctgcagcgtgtgggccactttgaccctgtgacccggagccctctgacccaggaacag
ctcatccccaacttggccatgaaggaagtcattgacgctttcatctctgagaacggctgg
gtagaggactattga

DBGET integrated database retrieval system