KEGG   Mus musculus (mouse): 56426Help
Entry
56426             CDS       T01002                                 

Gene name
Pdcd10, 2410003B13Rik, Ccm3, Tfa15, Tfar15
Definition
(RefSeq) programmed cell death 10
  KO
K18269  programmed cell death protein 10
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    56426 (Pdcd10)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   56426 (Pdcd10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1241 FH2 CENP-L CREPT Med11 SabA_adhesion DUF5344 GCN5L1 SesA Syntaxin_2 TFIIF_beta
Motif
Other DBs
NCBI-GeneID: 56426
NCBI-ProteinID: NP_062719
MGI: 1928396
Ensembl: ENSMUSG00000027835
Vega: OTTMUSG00000031048
UniProt: Q8VE70
Position
3; 3 E3
AA seq 212 aa AA seqDB search
MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQ
DIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDE
INDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKT
YFKDGKAINVFISANRLIHQTNLILQTFKTVA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgacaatggaagagatgaagaatgaagctgagaccacttccatggtttctatg
cctctctatgcagtcatgtatcctgtgtttaatgagctagaacgagtaaatttgtctgca
gctcagactctgagagccgctttcattaaggctgaaaaggaaaatccaggcctcacacaa
gacatcattatgaaaatattagagaaaaaaagtgtagaagttaacttcaccgagtccctc
cttcgtatggcagctgatgacgtagaagagtacatgattgagcggccagagccagaattc
caggacctaaatgaaaaggcacgggcacttaaacagattctcagtaagattcctgatgag
atcaatgacagagtgaggtttctgcagacaatcaaggatatagctagtgcaataaaagaa
ctacttgatacagtgaataatgtcttcaaaaaatatcagtaccagaaccgcagggcactt
gaacaccaaaagaaagaatttgtaaaatactccaaaagtttcagtgacactctgaagact
tattttaaagatggcaaggcaataaatgtgttcataagtgccaaccggctaattcatcaa
accaacttgatacttcagaccttcaaaactgtggcctga

DBGET integrated database retrieval system