KEGG   Mus musculus (mouse): 56428
Entry
56428             CDS       T01002                                 

Gene name
Mtch2, 2310034D24Rik, 4930539J07Rik, HSPC0, HSPC032
Definition
(RefSeq) mitochondrial carrier 2
  KO
K17885  mitochondrial carrier
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    56428 (Mtch2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    56428 (Mtch2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    56428 (Mtch2)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   56428 (Mtch2)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 56428
NCBI-ProteinID: NP_062732
MGI: 1929260
Ensembl: ENSMUSG00000027282
Vega: OTTMUSG00000014305
UniProt: Q791V5
Position
2; 2 E1
AA seq 303 aa
MADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFCYAQH
IASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQYYQESEKPEELGSVTVQKEYSSSFDRV
IKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIVTIYREEGIVGFFA
GLIPRLLGDIISLWLCNSLAYLINTYALDSGVSTMNEMKSYSQAVTGFFASMLTYPFVLV
SNLMAVNNCGLAGGSPPYSPIYTSWIDCWCMLQKAGNMSRGNSLFFRKVPCGKTYCYDLR
MLI
NT seq 912 nt   +upstreamnt  +downstreamnt
atggcggacgcggccagtcaggtgctcctgggctccggtctcaccatcctgtcccagccg
ctcatgtacgtgaaagtgctcatccaggtgggatatgagcctcttcctccaacaatagga
cgaaatatttttgggcgacaagtatgtcagcttcctggcctcttttgctatgctcagcac
attgcaagcatcgatgggaggcgtgggttgttcacaggcttgactccaagactgtgttca
ggagtccttggaactgtggtccatgggaaagtcttacagtattaccaggagtctgagaaa
cctgaggagttaggatctgtaactgtacaaaaagaatattcatcctcctttgaccgagtt
atcaaagagacaactcgagagatgattgctcgttctgctgctaccctcattacacatccc
ttccacgtgatcactctgaggtccatggtacagtttattggcagagagtctaagtactgt
ggactgtgtgactccatagtaaccatctaccgggaagaaggcatcgtaggattttttgcg
ggtctcattcctcgcctcctaggtgacatcatttctttgtggctgtgtaactcactggcc
tatctcatcaatacctatgcactggacagtggggtttctaccatgaatgaaatgaaaagt
tactcccaagctgtcacaggattctttgccagtatgttgacatatccctttgtgcttgta
tctaatcttatggccgtcaacaactgtgggcttgctggtggatctcctccttattcccca
atatacacttcttggatagattgctggtgcatgctacaaaaagcgggaaatatgagccga
ggaaacagcttgtttttccggaaggttccttgtgggaagacttactgttatgacctaaga
atgttaatctga

DBGET integrated database retrieval system