KEGG   Mus musculus (mouse): 56431Help
Entry
56431             CDS       T01002                                 

Gene name
Dstn, 2610043P17Rik, ADF, AU042046, Dsn, corn1, sid23p
Definition
(RefSeq) destrin
  KO
K10363  destrin (actin-depolymerizing factor)
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    56431 (Dstn)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     56431 (Dstn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cofilin_ADF
Motif
Other DBs
NCBI-GeneID: 56431
NCBI-ProteinID: NP_062745
MGI: 1929270
Ensembl: ENSMUSG00000015932
Vega: OTTMUSG00000003226
UniProt: Q9R0P5 Q4FK36
Position
2 G1; 2 70.89 cM
AA seq 165 aa AA seqDB search
MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIVVEEGKEILVGDV
GATITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPEQAPLKSKMIYASS
KDAIKKKFPGIKHEYQANGPEDLNRTCIAEKLGGSLIVAFEGSPV
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaggagttcaggttgcggatgaagtatgtcgcattttctacgacatgaaagtt
cggaaatgttccacaccagaagaaatcaagaaaagaaagaaggctgtcattttctgtctc
agtgcagacaaaaagtgcatagtcgttgaagaaggcaaagagatcttggtgggagatgtt
ggcgccaccataactgatcctttcaagcattttgtcggaatgcttcctgaaaaagattgt
cgctatgctttgtatgacgccagctttgagaccaaggagtccaggaaagaagagctgatg
ttcttcctgtgggcaccagaacaagcacctctgaaaagtaaaatgatctatgcaagctcg
aaggatgccatcaagaagaaatttccaggtataaagcatgagtatcaagcaaatgggcca
gaagacctcaatcggacctgtattgctgaaaagctaggtggctccttaattgtagccttt
gaaggatcccctgtgtag

DBGET integrated database retrieval system