KEGG   Mus musculus (mouse): 56445Help
Entry
56445             CDS       T01002                                 

Gene name
Dnaja2, 1500017M13Rik, 2010206B19Rik, DNAJ, DNJ3, Dnaj3, HIRIP4, PRO3015, mDj3
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member A2
  KO
K09503  DnaJ homolog subfamily A member 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    56445 (Dnaja2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    56445 (Dnaja2)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    56445 (Dnaja2)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   56445 (Dnaja2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    56445 (Dnaja2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP HypA
Motif
Other DBs
NCBI-GeneID: 56445
NCBI-ProteinID: NP_062768
MGI: 1931882
Ensembl: ENSMUSG00000031701
Vega: OTTMUSG00000061420
UniProt: Q9QYJ0
Position
8; 8 C3
AA seq 412 aa AA seqDB search
MANVADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNP
EKRELYDRYGEQGLREGSGGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPL
KVSLEDLYNGKTTKLQLSKNVLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQ
QMQSVCSDCNGEGEVINEKDRCKKCEGKKVIKEVKILEVHVDKGMKHGQRITFTGEADQA
PGVEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDARQIVVKYPP
GKVIEPGCVRVVRGEGMPQYRNPFEKGDLYIKFDVQFPENNWINPDKLSELEDLLPSRPE
VPNVIGETEEVELQEFDSTRGSGGGQRREAYNDSSDEESSSHHGPGVQCAHQ
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgtggccgacacgaagctgtacgacatcctgggcgtccctcccggcgctagc
gagaacgagctgaagaaggcataccgaaagttagccaaagaataccaccctgataagaat
ccaaatgctggagacaaatttaaagaaataagttttgcatatgaagtattgtcaaatcca
gagaagcgagagctgtatgacagatatggagaacaaggcctacgggaaggcagcggcgga
ggcggtggcatggatgatatcttctcacatatttttggtggaggattgtttggctttatg
ggcaatcagagtagaagtcgaaatggcagaagaagaggcgaggacatgatgcatccacta
aaagtatctttagaagacctgtacaatggcaagacaaccaaactacaacttagcaagaat
gtgctctgtagtgcatgcagtggccaaggtgggaagtctggagctgttcagaaatgcagc
gcttgtcggggtcgaggtgtgcgcattatgatcagacagctggctccaggaatggtgcag
cagatgcagtccgtgtgctccgactgtaatggagaaggggaggtcatcaatgaaaaagac
cgctgtaaaaaatgtgaagggaagaaggtaatcaaagaagtcaagattctggaagtccat
gtagacaaaggcatgaaacatggacagaggattacgttcactggggaagcagaccaggct
ccaggagtggaacctggagatattgttcttttgctacaggaaaaagaacatgaggtgttc
cagagagatgggaatgatttgcatatgacatataagataggacttgttgaagctttatgt
ggatttcagttcacatttaaacatcttgatgctcgtcagattgtggtgaaatacccccct
ggcaaagtaattgaaccaggatgtgttcgtgttgttcgaggtgaaggaatgccacagtat
cgtaatccctttgaaaagggtgatctctacataaagtttgatgtacagtttcctgagaat
aactggatcaacccagacaaactttctgaattagaagatctcctgccatctagaccagaa
gttcctaatgttattggagagacagaagaagtggagcttcaggaatttgatagcactcga
ggctctggcggtggtcagagacgtgaagcctataatgatagctctgatgaagaaagtagc
agccatcatggacctggagtgcagtgtgcccatcagtaa

DBGET integrated database retrieval system