KEGG   Mus musculus (mouse): 56453
Entry
56453             CDS       T01002                                 

Gene name
Mbtps1, 0610038M03Rik, AV003995, S, S1P, SKI, SKI-1, Ski1, mKIAA0091
Definition
(RefSeq) membrane-bound transcription factor peptidase, site 1
  KO
K08653  membrane-bound transcription factor site-1 protease [EC:3.4.21.112]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    56453 (Mbtps1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    56453 (Mbtps1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    56453 (Mbtps1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.112  site-1 protease
     56453 (Mbtps1)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S8: subtilisin family
   56453 (Mbtps1)
Chaperones and folding catalysts [BR:mmu03110]
 Intramolecular chaperones
  Subtilisin family
   56453 (Mbtps1)
SSDB
Motif
Pfam: Peptidase_S8 DUF4350
Other DBs
NCBI-GeneID: 56453
NCBI-ProteinID: NP_001161382
MGI: 1927235
Ensembl: ENSMUSG00000031835
Vega: OTTMUSG00000061639
UniProt: Q9WTZ2
Position
8; 8 E1
AA seq 1052 aa
MKLVSTWLLVLVVLLCGKRHLGDRLGTRALEKAPCPSCSHLTLKVEFSSTVVEYEYIVAF
NGYFTAKARNSFISSALKSSEVENWRIIPRNNPSSDYPSDFEVIQIKEKQKAGLLTLEDH
PNIKRVTPQRKVFRSLKFAESNPIVPCNETRWSQKWQSSRPLKRASLSLGSGFWHATGRH
SSRRLLRAIPRQVAQTLQADVLWQMGYTGANVRVAVFDTGLSEKHPHFKNVKERTNWTNE
RTLDDGLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTNNQVSYTSWFLDAFNYAILKK
MDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPADQMDVIGVGG
IDFEDNIARFSSRGMTTWELPGGYGRVKPDIVTYGAGVRGSGVKGGCRALSGTSVASPVV
AGAVTLLVSTVQKRELVNPASVKQALIASARRLPGVNMFEQGHGKLDLLRAYQILSSYKP
QASLSPSYIDLTECPYMWPYCSQPIYYGGMPTIVNVTILNGMGVTGRIVDKPEWRPYLPQ
NGDNIEVAFSYSSVLWPWSGYLAISISVTKKAASWEGIAQGHIMITVASPAETELHSGAE
HTSTVKLPIKVKIIPTPPRSKRVLWDQYHNLRYPPGYFPRDNLRMKNDPLDWNGDHVHTN
FRDMYQHLRSMGYFVEVLGAPFTCFDATQYGTLLLVDSEEEYFPEEIAKLRRDVDNGLSL
VIFSDWYNTSVMRKVKFYDENTRQWWMPDTGGANIPALNELLSVWNMGFSDGLYEGEFVL
ANHDMYYASGCSIAKFPEDGVVITQTFKDQGLEVLKQETAVVENVPILGLYQIPSEGGGR
IVLYGDSNCLDDSHRQKDCFWLLDALLQYTSYGVTPPSLSHSGNRQRPPSGAGLAPPERM
EGNHLHRYSKVLEAHLGDPKPRPLPACPHLSWAKPQPLNETAPSNLWKHQKLLSIDLDKV
VLPNFRSNRPQVRPLSPGESGAWDIPGGIMPGRYNQEVGQTIPVFAFLGAMVALAFFVVQ
ISKAKSRPKRRRPRAKRPQLAQQAHPARTPSV
NT seq 3159 nt   +upstreamnt  +downstreamnt
atgaagctcgtcagcacctggcttcttgtgctggtggttttgctctgtgggaaacggcac
ctgggcgacaggctggggacgagagctttggaaaaggccccgtgccccagctgctcccac
ctgactttgaaggtggaattctcttcaactgtggtggagtacgaatatattgtggctttc
aacggatacttcacagccaaagctagaaactcatttatttcaagtgctctgaaaagcagt
gaagtggaaaactggagaataatacctcggaacaacccatccagtgactaccctagtgat
tttgaggtgattcagataaaagagaagcagaaggcggggctgctcacacttgaagatcac
cccaacatcaagcgggtgacaccccagcggaaagtctttcgttccctcaagtttgctgaa
tccaaccccatcgtgccctgtaatgaaacccggtggagccagaagtggcagtcatcacgt
cccctgaaaagagccagtctctccctgggctctggattctggcatgcaacaggaagacat
tcaagtcggcgattgctgagagccattcctcgccaggtcgcccagacactgcaggcagat
gtgctgtggcagatgggatacacaggtgctaatgtcagagttgctgtttttgatactggg
ctcagtgagaagcatccgcattttaagaatgtgaaggagagaaccaactggaccaatgag
cggaccctggatgatgggctaggccatggcacattcgttgcaggtgtgattgccagcatg
agggagtgccaaggatttgctccagatgcagagctgcacatcttcagggtctttaccaac
aatcaggtgtcttacacatcttggtttctggatgccttcaactatgccatcctaaagaag
atggacgttctcaaccttagcatcggtgggcccgacttcatggatcatccgtttgttgac
aaggtgtgggaattaacagctaacaatgtaattatggtttctgctattggcaatgatgga
cctctctatggcactctgaataaccctgctgatcagatggatgtgattggagtgggtggc
attgactttgaagataacatcgctcgcttttcttccaggggaatgactacctgggaatta
ccaggaggctatggtcgtgtgaagcctgacattgtcacctatggtgctggagtgcggggt
tccggtgtgaaagggggctgccgtgcactctcagggaccagtgtcgcttccccagtggtc
gctggggccgtcaccttgttagtaagcacagtacagaagcgggagctggtgaatcctgcc
agtgtgaagcaagctttgatagcgtcagcccggagacttcctggggtcaacatgttcgag
caaggtcatggcaagttggatctgctgcgagcttatcagatcctcagcagctataaaccg
caggcaagcctgagtcctagctacatcgacctgactgagtgtccctacatgtggccctac
tgctcccagcctatctactatggaggaatgccaacaatcgttaatgtcaccatcctcaat
ggcatgggcgtcacaggaagaattgtggataagcctgagtggcgaccctatttaccacag
aatggagacaacattgaagtggccttctcctactcctcagtgttgtggccctggtcaggt
taccttgccatctccatttctgtgaccaagaaggcagcttcctgggaaggcatcgctcag
ggccacatcatgatcacagtggcgtccccagcagagacagagttacacagtggtgcggag
cacacttccaccgtgaagctgcccatcaaggtgaagatcattcccacccctcctcggagc
aagagagtcctctgggaccagtaccacaacctccgctacccacctggctacttccccagg
gacaacttgcggatgaagaatgaccctttagactggaatggcgaccacgtccacaccaac
ttcagggacatgtaccagcatctgcgcagcatgggctacttcgtggaggtgctcggcgcc
ccattcacatgttttgacgccacacagtatggcactttgctgctggtggacagtgaggaa
gagtacttccctgaggagattgctaagctgaggagggatgtggacaatggcctttccctc
gtcatcttcagtgactggtacaacacttctgttatgagaaaagtgaagttttatgatgaa
aacaccaggcagtggtggatgccagacaccggaggagcgaacatcccagctctgaatgag
ctgctgtctgtgtggaacatggggttcagtgacggcctatatgaaggggagtttgtcctg
gcaaaccatgacatgtactatgcgtcggggtgcagcatcgccaagtttccagaagatggc
gtcgtgatcacacagactttcaaggaccaaggattggaggtcttaaaacaagagacagca
gttgtggaaaatgttcccattttggggctttatcagattccatctgaaggtggaggccgg
atcgtgctgtatggagactccaactgcttggatgacagtcacagacagaaggactgcttt
tggcttctggatgcgctccttcagtacacatcctatggcgtgacccctcccagcctcagc
cattcagggaaccggcagcgcccacctagcggagccggcttggcccctcctgaaaggatg
gaaggaaaccacctccatcggtactccaaagttcttgaagcccacttgggagacccgaaa
cctcggcccctgccagcctgtccacatttgtcatgggccaagccacagcctttgaatgag
acggcacccagtaatctttggaaacatcagaagctgctctccattgacctggacaaagta
gtgttacccaactttcgatccaatcgccctcaagtgagacctttgtcccctggagagagt
ggtgcctgggacattcctggagggatcatgcctggccgctacaaccaggaggtgggacag
accatccccgtcttcgccttcctcggagccatggtggccctggccttctttgtggtacag
atcagcaaggccaagagccggccgaagcggaggaggcccagggcaaagcgtccacaactt
gcacagcaggcccaccctgcaaggaccccatcagtgtga

DBGET integrated database retrieval system