KEGG   Mus musculus (mouse): 56455
Entry
56455             CDS       T01002                                 

Gene name
Dynll1, Dlc8, Dnclc1, Pin
Definition
(RefSeq) dynein light chain LC8-type 1
  KO
K10418  dynein light chain LC8-type
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04962  Vasopressin-regulated water reabsorption
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    56455 (Dynll1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    56455 (Dynll1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    56455 (Dynll1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     56455 (Dynll1)
SSDB
Motif
Pfam: Dynein_light
Other DBs
NCBI-GeneID: 56455
NCBI-ProteinID: NP_062656
MGI: 1861457
Ensembl: ENSMUSG00000009013
Vega: OTTMUSG00000014648
UniProt: P63168
Position
5; 5 F
AA seq 89 aa
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGR
NFGSYVTHETKHFIYFYLGQVAILLFKSG
NT seq 270 nt   +upstreamnt  +downstreamnt
atgtgcgaccggaaggcggtgatcaaaaatgcagacatgtcggaagagatgcaacaggac
tcggtggagtgcgctacccaggcgttggagaagtacaacatcgagaaggatattgcggcc
catatcaagaaggagtttgacaagaagtacaaccctacctggcactgcattgtgggccga
aacttcggtagttatgtgacacatgaaaccaaacacttcatctacttctacctgggtcag
gtggccattcttctgttcaaatctggttaa

DBGET integrated database retrieval system