KEGG   Mus musculus (house mouse): 56464
Entry
56464             CDS       T01002                                 
Symbol
Ctsf, AI481912
Name
(RefSeq) cathepsin F
  KO
K01373  cathepsin F [EC:3.4.22.41]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04142  Lysosome
mmu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    56464 (Ctsf)
  09143 Cell growth and death
   04210 Apoptosis
    56464 (Ctsf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    56464 (Ctsf)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.41  cathepsin F
     56464 (Ctsf)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C1: papain family
   56464 (Ctsf)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Other DBs
NCBI-GeneID: 56464
NCBI-ProteinID: NP_063914
MGI: 1861434
Ensembl: ENSMUSG00000083282
UniProt: Q9R013
Position
19:4905153..4910946
AA seq 462 aa
MAPLLQLLWLLTLLSTVALSPVPAKPWADDEQAWNLSSQELLAPARFALDMYNYGRAAGT
RAVLGAVRGRVRRAGQGSLFSLEATLEEPPCNDPLVCPLPETKKTVLCSFEVLEELKEHL
LLRRDCSPVNAKVTEFRNATFSSFLPLLDKDPLPQDFSVKMAPLFKDFMTTYNRTYESRE
EAQWRLTVFARNMIRAQKIQALDRGTAQYGITKFSDLTEEEFHTIYLNPLLQKESGRKMS
PAKSINDLAPPEWDWRKKGAVTEVKNQGMCGSCWAFSVTGNVEGQWFLNRGTLLSLSEQE
LLDCDKVDKACLGGLPSNAYAAIKNLGGLETEDDYGYQGHVQTCNFSAQMAKVYINDSVE
LSRNENKIAAWLAQKGPISVAINAFGMQFYRHGIAHPFRPLCSPWFIDHAVLLVGYGNRS
NIPYWAIKNSWGSDWGEEGYYYLYRGSGACGVNTMASSAVVN
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggcgcccctactgcagcttctgtggctgctgacactgctctcgactgtggccctgagc
cccgtccccgccaagccctgggcagatgacgagcaggcctggaacttgtcgtcccaggag
ctgctggcccccgcccgcttcgcgctggacatgtacaattacggccgtgctgcggggaca
agggccgtgctaggagcggtgcgcggacgcgtccgccgggccggccagggctctctgttc
tccctggaagccacactagaggagccaccttgcaatgatcccctggtgtgcccactgcct
gagacgaagaaaacagtgctctgcagttttgaagtcctggaagagctaaaagaacacttg
ctgctgaggagggactgtagcccagtgaatgccaaggtcacagagtttagaaatgcgact
ttcagctcattccttccattgttggacaaggatcccctgccccaggacttctctgtgaag
atggctccactcttcaaggacttcatgaccacctataaccggacttatgaatcaagggaa
gaagcccagtggcgattgactgtctttgcaagaaatatgatacgagcacagaagattcag
gccctggaccgcggcacagctcagtatgggatcaccaagttcagtgacctcacagaggag
gaattccacaccatctacctgaatcccctcttacagaaggagtctggcaggaagatgagt
ccagccaagtccataaatgatcttgccccgcctgaatgggactggaggaagaaaggggct
gtcactgaagtgaagaaccagggcatgtgtggctcctgctgggccttttctgtcacaggc
aacgtggagggccagtggttcctgaaccgggggactctgctctccctgtcagagcaggag
ctcttggattgtgacaaggtggacaaggcctgcttgggtggattgccctccaacgcctat
gcagccataaagaatttgggagggctggagacagaggatgactacggctaccagggccat
gttcagacctgcaacttctcagcacagatggcaaaagtctacatcaatgattcagtggag
ctgagccggaatgaaaataagatagcagcctggctggcccagaaaggacctatctcagtt
gccattaacgccttcggcatgcagttctatcgccacgggattgctcacccattccggccc
ctctgcagcccttggttcatcgaccatgctgtgttgctggtgggctatggcaaccgctct
aacattccttactgggccatcaagaacagctggggcagtgactggggtgaggagggttac
tactacttgtaccgtggatctggagcctgtggtgtgaataccatggccagctcagccgtg
gtgaactga

DBGET integrated database retrieval system