KEGG   Mus musculus (house mouse): 56469
Entry
56469             CDS       T01002                                 
Symbol
Pias1, 2900068C24Rik, Ddxbp1, GBP
Name
(RefSeq) protein inhibitor of activated STAT 1
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04630  JAK-STAT signaling pathway
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    56469 (Pias1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    56469 (Pias1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    56469 (Pias1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    56469 (Pias1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    56469 (Pias1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-
     56469 (Pias1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   56469 (Pias1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    56469 (Pias1)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse FAM53
Other DBs
NCBI-GeneID: 56469
NCBI-ProteinID: NP_062637
MGI: 1913125
Ensembl: ENSMUSG00000032405
UniProt: O88907 Q2M4G9
Position
9:complement(62785648..62888161)
AA seq 651 aa
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
YRRRFPQKIMTPADLSIPNVHSSPMPPTLSPSTIPQLTYDGHPASSPLLPVSLLGPKHEL
ELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQ
ISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRTYSMAVYLVKQLSSTVLLQRLRAK
GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDAT
LYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGSWAPMRSKK
EVQEVTASYNGVDGCLSSTLEHQVASHNQSSNKNKKVEVIDLTIDSSSDEEEEEPPAKRT
CPSLSPTSPLSNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDL
QGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTS
LPATNGSSSGSNSSLVSSNSLRESHGHGVASRSSADTASIFGIIPDIISLD
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggcggacagtgcggaactaaagcaaatggttatgagccttagagtttctgaactccaa
gtactgttgggctacgctgggaggaacaagcacggacgcaaacacgaacttcttacaaaa
gccctgcatttgttaaaggctggctgtagtcctgctgtacaaatgaaaattaaagaactc
tacaggaggcggttccctcagaaaattatgacgcctgcggacttgtctatccccaacgta
cattcaagtcctatgcctccgactctttctccatccaccattccacagctcacttatgat
ggccaccctgcatcatccccactactccctgtttctcttctgggacccaaacatgaactg
gaactcccacatctcacgtcagcgctgcacccagtccacccggacataaagctgcagaag
ctaccattctatgacctgttggatgaactgatcaagcccaccagtctagcttcagacaac
agccagcgctttcgggaaacctgttttgcatttgccttgacaccacaacaggtgcagcag
atcagcagctccatggatatttctgggaccaaatgtgacttcacagtgcaggtccaatta
aggttttgtttatcagaaaccagttgtccacaagaagatcacttcccacccaacctttgt
gtaaaagtgaatacaaaaccttgcagccttccaggttaccttccacctactaaaaacggt
gtggaaccaaagcgacctagccgaccaattaatatcacctcacttgtccgattgtccacg
acagtaccaaataccattgttgtttcttggactgcagaaattggaagaacctattccatg
gcagtatatcttgtaaaacagttgtcctcaacagttcttcttcagaggttacgagcaaag
ggaataaggaatccggatcattctagagctttaattaaagagaagttaactgcagatcca
gatagtgagatagctactaccagcctacgggtttcgctgctgtgtccacttgggaaaatg
cgactgacaatcccctgtcgggcacttacctgctcccaccttcagtgttttgatgcaact
ctttacattcaaatgaatgagaaaaaaccaacatgggtttgtcctgtctgtgataagaag
gccccatatgaacaccttattattgacgggttgtttatggaaattctaaagtactgcaca
gactgtgacgagatacagtttaaggaggatggctcgtgggctccaatgaggtcaaagaag
gaggttcaagaagtcactgcctcctacaatggagttgatggttgcttgagctccacattg
gagcatcaggtagcgtcccacaaccagtcctcaaataaaaacaagaaagtcgaggtcatt
gacctaaccattgacagctcgtcagatgaagaggaggaagaaccccctgccaagaggacc
tgtccttccctgtctcctacgtcaccactaagtaataaaggcattttaagtcttcctcat
caagcctcgcctgtgtcccgcaccccaagccttcctgctgtagatacaagctacatcaac
acctccctcatccaggactacaggcaccccttccacatgacgcctatgccttatgactta
caaggattagatttctttcctttcttatcaggagacaatcagcattacaacacctccctg
ctagccgcagctgcagcggcggtctcagatgaccaggacctcctgcactcctcccggttt
ttcccgtatacctcctcgcagatgtttctcgaccagctaagtgcaggagggagcacatct
ctgccagccaccaacggaagcagtagcggcagcaacagcagccttgtgtcttccaacagt
ctgagagagagccatggccatggtgtggccagcaggagcagcgcagacacagcgtccatc
tttggcatcataccagacattatctcattggactga

DBGET integrated database retrieval system