KEGG   Mus musculus (mouse): 56470
Entry
56470             CDS       T01002                                 

Symbol
Rgs19, 2610042F04Rik, AI324841, AW547781, GAIP
Name
(RefSeq) regulator of G-protein signaling 19
  KO
K16449  regulator of G-protein signaling
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    56470 (Rgs19)
SSDB
Motif
Pfam: RGS
Other DBs
NCBI-GeneID: 56470
NCBI-ProteinID: NP_001278135
MGI: 1915153
Ensembl: ENSMUSG00000002458
Vega: OTTMUSG00000016814
UniProt: Q9CX84 Q78NN4
Position
2 H4; 2 103.72 cM
AA seq 216 aa
MPTPHEAEKQHTGPEEADRPPSMSSHDAAPSGPPSRNPCCLCWCCCCSCSWNQERQRAWQ
VSRESKLQPLPSCEVCTPPSPKEVQSWAQSFDKLMHSPTGRSVFRAFLRTEYSEENMLFW
LACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINRKMQEPSPHTFDDA
QLQIYTLMHRDSYPRFLTSPTYRSLLLQGAPQSSEA
NT seq 651 nt   +upstreamnt  +downstreamnt
atgcccaccccacatgaggctgagaaacagcacacagggccagaggaggcagacaggcct
ccctcgatgtccagccatgacgcagccccctcaggacctcccagtcgcaatccctgctgc
ttatgctggtgctgctgctgtagctgctcctggaaccaagaacggcaacgagcttggcag
gtttctcgggaaagcaagctgcaacccctccccagctgtgaagtctgcactccaccaagc
cctaaggaagtacagagctgggcacagtcctttgacaagttgatgcatagccccacgggc
cgcagtgtattccgggcattcctgcgcacagaatacagcgaagagaacatgctcttctgg
ctggcttgtgaggagttgaaagcagaggccaaccaacatgtggtggacgagaaggcgcga
cttatctatgaggactacgtgtccatcctgtcccccaaggaggtaagcctggactcccgt
gtgcgagaaggcatcaataggaagatgcaagagccatcgccacacacatttgatgatgca
cagctgcagatctacaccctcatgcaccgggactcgtaccctcgattccttacctccccc
acctaccgctctctattactccagggggccccacagtcctctgaggcctag

DBGET integrated database retrieval system