KEGG   Mus musculus (mouse): 56471
Entry
56471             CDS       T01002                                 

Gene name
Stmn4, Lagl, R75359, RB, RB3
Definition
(RefSeq) stathmin-like 4
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Stathmin Pex19
Other DBs
NCBI-GeneID: 56471
NCBI-ProteinID: NP_062649
MGI: 1931224
Ensembl: ENSMUSG00000022044
Vega: OTTMUSG00000027814
UniProt: P63042
Position
14; 14 D1
AA seq 189 aa
MTLAAYKEKMKELPLVSLFCSCFLSDPLNKSSYKYEADTVDLNWCVISDMEVIELNKCTS
GQSFEVILKPPSFDGVPEFNASLPRRRDPSLEEIQKKLEAAEERRKYQEAELLKHLAEKR
EHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERLQEKDKHAEEVRKN
KELKEEASR
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactcttgcagcctataaggagaagatgaaggaactcccactagtgtctctgttctgc
tcttgcttcttgtctgatcccctgaataaatcatcctacaaatatgaagcagatacagta
gacctgaactggtgcgtcatctctgatatggaagtcatcgagctgaacaagtgcacctcg
ggccagtcctttgaagtcatcttgaagccaccttcctttgacggggtgcctgagtttaat
gcctccctcccaagacggcgagacccatcattagaagagattcagaagaagctagaagca
gcagaggagcgaaggaagtaccaggaagctgaactcctgaaacacctcgcggagaaacga
gagcacgagcgagaggtgatccagaaagctatcgaagaaaacaataacttcatcaagatg
gcaaaagagaagctggcccagaagatggagtccaataaggagaaccgggaggcccatctg
gctgccatgttggagcggctgcaagagaaggacaagcacgcagaggaggtgcggaaaaac
aaggagctgaaggaagaggcctccaggtaa

DBGET integrated database retrieval system