KEGG   Mus musculus (mouse): 56484
Entry
56484             CDS       T01002                                 

Gene name
Foxo3, 1110048B16Rik, 2010203A17Rik, C76856, FKHRL1, Fkhr2, Foxo3a
Definition
(RefSeq) forkhead box O3
  KO
K09408  forkhead box protein O3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04062  Chemokine signaling pathway
mmu04068  FoxO signaling pathway
mmu04137  Mitophagy - animal
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04218  Cellular senescence
mmu04722  Neurotrophin signaling pathway
mmu04917  Prolactin signaling pathway
mmu05213  Endometrial cancer
mmu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    56484 (Foxo3)
   04151 PI3K-Akt signaling pathway
    56484 (Foxo3)
   04152 AMPK signaling pathway
    56484 (Foxo3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    56484 (Foxo3)
  09143 Cell growth and death
   04218 Cellular senescence
    56484 (Foxo3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    56484 (Foxo3)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    56484 (Foxo3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    56484 (Foxo3)
  09149 Aging
   04211 Longevity regulating pathway
    56484 (Foxo3)
   04213 Longevity regulating pathway - multiple species
    56484 (Foxo3)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    56484 (Foxo3)
   05223 Non-small cell lung cancer
    56484 (Foxo3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    56484 (Foxo3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    56484 (Foxo3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    56484 (Foxo3)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 56484
NCBI-ProteinID: NP_062714
MGI: 1890081
Ensembl: ENSMUSG00000048756
Vega: OTTMUSG00000020929
UniProt: Q9WVH4
Position
10 B2; 10 22.79 cM
AA seq 672 aa
MAEAPASPVPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEE
DDDEDDEDGGGRASSAMVIGGGVSSTLGSGLLLEDSAMLLAPGGQDLGSGPASAAGALSG
GTPTQLQPQQPLPQPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLS
QIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGG
KSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQAAPESADDSPSQLSKWPGSPTSRSSD
ELDAWTDFRSRTNSNASTVSGRLSPILASTELDDVQDDDGPLSPMLYSSSASLSPSVSKP
CTVELPRLTDMAGTMNLNDGLAENLMDDLLDNIALPPSQPSPPGGLMQRGSSFPYTAKSS
GLGSPTGSFNSTVFGPSSLNSLRQSPMQTIQENRPATFSSVSHYGNQTLQDLLASDSLSH
SDVMMTQSDPLMSQASTAVSAQNARRNVMLRNDPMMSFAAQPTQGSLVNQNLLHHQHQTQ
GALGGSRALSNSVSNMGLSDSSSLGSAKHQQQSPASQSMQTLSDSLSGSSLYSASANLPV
MGHDKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTG
AKQASSQSWVPG
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggcagaggcaccagcctccccggtcccgctctctccgctcgaagtggagctggaccca
gagttcgagccacagagtcggccacgctcctgtacgtggcccctgcagaggccggagctg
caggcgagcccggccaagccctcgggggagacggccgcagactccatgatccccgaggag
gacgacgatgaagacgacgaggacggcggcggccgagccagctcggccatggtgatcggt
ggcggcgtgagcagcacgctgggttccgggctgctcctcgaggattcggccatgctgctg
gctccaggagggcaggacctcgggtcggggccagcgtccgccgcaggcgctctgagtggg
ggcacgccgacgcagctgcagcctcagcagccactgccacagccgcagccgggggcggct
gggggctctgggcaaccaaggaaatgctcctcgcggcggaatgcctgggggaacctgtcc
tatgccgacctgatcacccgcgccatcgagagctccccggacaaacggctcactttgtcc
cagatctacgagtggatggtgcgctgtgtgccctacttcaaggataagggcgacagcaac
agctctgcgggctggaagaactccatccggcacaacctgtccctgcacagccgcttcatg
cgcgttcagaatgaaggcacgggcaagagctcttggtggatcatcaaccccgatggggga
aagagcgggaaggccccccggcggcgtgcggtctccatggacaacagcaacaagtacacc
aagagccgaggccgggcagccaagaagaaggcggccctgcaggctgccccagagtcggca
gacgacagtccttcccagctctccaagtggcctggcagccccacgtcccgcagcagcgac
gagctggatgcgtggaccgacttccgctcgcgcaccaattccaacgccagcaccgtgagc
ggccgcctgtcgcccatcctggcaagcacggagctggatgacgtccaggatgatgatgga
cccctgtcccccatgctgtacagcagctctgccagcctgtcgccctccgtgagcaagccg
tgtactgtggagcttccgcggctgacggacatggccggcaccatgaatctgaatgatggg
ctggccgagaacctcatggacgacctgctggataacatcgcgctcccgccatcgcagcca
tcgcctcctggcgggcttatgcagcggggctccagcttcccatataccgccaagagctcc
ggcctgggctccccaaccggctccttcaacagtaccgtgtttggaccttcgtctctgaac
tccttgcgtcagtcacccatgcagactatccaggagaacagaccagccaccttctcttcc
gtgtcacactacggcaaccagacactccaagacctgcttgcttcagactcactcagccac
agcgacgtcatgatgacccagtcggaccccttgatgtctcaggctagcaccgccgtgtcc
gcccagaatgcccgccggaacgtgatgcttcgcaacgatccaatgatgtcctttgctgcc
cagcctacccaggggagtttggtcaatcagaacttgctccaccaccagcaccaaacccag
ggcgctcttggtggcagccgtgccttgtcaaattctgtcagcaacatgggcttgagtgac
tccagcagccttggctcagccaaacaccagcagcagtctcccgccagccagtctatgcaa
accctctcggactctctctcaggctcctcactgtattcagctagtgcaaaccttcccgtc
atgggccacgataagttccccagtgacttggacctggacatgttcaatgggagcttggaa
tgtgacatggagtccatcatccgtagtgaactcatggatgctgacgggttggattttaac
tttgactccctcatctccacacagaacgttgttggtttgaatgtggggaacttcactggt
gctaagcaggcctcatctcaaagctgggtaccaggctga

DBGET integrated database retrieval system