KEGG   Mus musculus (house mouse): 56486
Entry
56486             CDS       T01002                                 
Symbol
Gabarap
Name
(RefSeq) gamma-aminobutyric acid receptor associated protein
  KO
K08341  GABA(A) receptor-associated protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04136  Autophagy - other
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu04621  NOD-like receptor signaling pathway
mmu04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    56486 (Gabarap)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    56486 (Gabarap)
   04136 Autophagy - other
    56486 (Gabarap)
   04137 Mitophagy - animal
    56486 (Gabarap)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    56486 (Gabarap)
  09156 Nervous system
   04727 GABAergic synapse
    56486 (Gabarap)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    56486 (Gabarap)
   04121 Ubiquitin system [BR:mmu04121]
    56486 (Gabarap)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    56486 (Gabarap)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    56486 (Gabarap)
Ubiquitin system [BR:mmu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   56486 (Gabarap)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    56486 (Gabarap)
SSDB
Motif
Pfam: ATG8 APG12
Other DBs
NCBI-GeneID: 56486
NCBI-ProteinID: NP_062723
MGI: 1861742
Ensembl: ENSMUSG00000018567
UniProt: Q9DCD6
Structure
Position
11:69882196..69885775
AA seq 117 aa
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagttcgtgtacaaagaggagcatccgttcgagaagcgccgctctgagggcgagaaa
atccgaaagaaatacccagaccgggtcccggtgatagtggaaaaagcccccaaagctcgg
ataggagacctggacaaaaagaaatacctggtgccttctgatcttacagttggtcaattc
tacttcttgatccggaagcgaattcatctccgtgctgaagatgccttgtttttctttgtc
aacaatgtcattccacccaccagtgccacgatgggtcagctgtaccaggaacaccatgaa
gaagacttctttctatacattgcctacagtgatgaaagcgtctatggtctgtga

DBGET integrated database retrieval system