KEGG   Mus musculus (mouse): 56488
Entry
56488             CDS       T01002                                 

Symbol
Nxt1, 1110001N02Rik
Name
(RefSeq) NTF2-related export protein 1
  KO
K14285  NTF2-related export protein 1/2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
mmu03013  Nucleocytoplasmic transport
mmu03015  mRNA surveillance pathway
mmu05014  Amyotrophic lateral sclerosis
mmu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    56488 (Nxt1)
   03015 mRNA surveillance pathway
    56488 (Nxt1)
   03008 Ribosome biogenesis in eukaryotes
    56488 (Nxt1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    56488 (Nxt1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    56488 (Nxt1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    56488 (Nxt1)
   03009 Ribosome biogenesis [BR:mmu03009]
    56488 (Nxt1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     56488 (Nxt1)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    56488 (Nxt1)
SSDB
Motif
Pfam: NTF2 Cofilin_ADF DUF4518
Other DBs
NCBI-GeneID: 56488
NCBI-ProteinID: NP_001103629
MGI: 1929619
Ensembl: ENSMUSG00000036992
Vega: OTTMUSG00000015709
UniProt: Q9QZV9
Position
2; 2 G3
AA seq 140 aa
MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE
FFEMLPSSEFQISVVDCQPVHDDATPSQTTVLVVICGTVKFEGNKQRDFNQNFILTAQAS
PSNTVWKIASDCFRFQDWAS
NT seq 423 nt   +upstreamnt  +downstreamnt
atggcatcagtagatttcaagacctatgtggaccaggcctgcagagctgcagaggaattt
gtcaatgtctattacacgactatggataagcggcgtcggctgctgtcccgcctgtacatg
ggcacagccactttagtatggaatggaaatgctgtttcaggacaagaatccttgagtgag
ttttttgagatgttgccttccagtgagttccaaatcagcgtggtagactgccagcctgtc
catgatgacgctacaccaagccagaccaccgtgcttgtggtcatctgtggaacagtgaag
tttgaaggcaacaaacagcgggacttcaaccagaacttcatcttgactgctcaggcgtca
cccagtaacacggtgtggaagatagcaagtgactgcttccggttccaggactgggccagc
tag

DBGET integrated database retrieval system