KEGG   Mus musculus (mouse): 56490
Entry
56490             CDS       T01002                                 

Gene name
Zbtb20, 1300017A20Rik, 7330412A13Rik, A930017C21Rik, D16Wsu73, D16Wsu73e, DPZF, HO, HOF, J20, ODA-8S, Oda8, Tg(PDGFB-APPSwInd)20Lms, Zfp28, Zfp288
Definition
(RefSeq) zinc finger and BTB domain containing 20
  KO
K10501  zinc finger and BTB domain-containing protein 20
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    56490 (Zbtb20)
   04121 Ubiquitin system [BR:mmu04121]
    56490 (Zbtb20)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    56490 (Zbtb20)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     56490 (Zbtb20)
Motif
Pfam: BTB zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2HC_2 zf-met zf-C2H2_6 zf-C2H2_jaz zf-C2H2_2 BolA zf-C2H2_11
Other DBs
NCBI-GeneID: 56490
NCBI-ProteinID: NP_001272734
MGI: 1929213
Ensembl: ENSMUSG00000022708
Vega: OTTMUSG00000025618
UniProt: Q8K0L9
Position
16 B4; 16 28.44 cM
AA seq 741 aa
MLERKKPKTAENQKASEENEITQPGGSSAKPALPCLNFEAVLSPAPALIHSTHSLTNSHA
HTGSSDCDISCKGMTERIHSINLHNFSNSVLETLNEQRNRGHFCDVTVRIHGSMLRAHRC
VLAAGSPFFQDKLLLGYSDIEIPSVVSVQSVQKLIDFMYSGVLRVSQSEALQILTAASIL
QIKTVIDECTRIVSQNVGDVFPGIQDSGQDTPRGTPESGTSGQSSDTESGYLQSHPQHSV
DRIYSALYACSMQNGSGERSFYSGAVVSHHETALGLPRDHHMEDPSWITRIHERSQQMER
YLSTTPETTHCRKQPRPVRIQTLVGNIHIKQEMEDDYDYYGQQRVQILERNESEECTEDT
DQAEGTESEPKGESFDSGVSSSIGTEPDSVEQQFGAAAPRDGQAEPAQPEQAAEAPAESS
AQPNQLEPGASSPERSNESEMDNTVITVSNSSDKGVLQQPSVNTSIGQPLPSTQLYLRQT
ETLTSNLRMPLTLTSNTQVIGTAGNTYLPALFTTQPAGSGPKPFLFSLPQPLTGQQTQFV
TVSQPGLSTFTAQLPAPQPLASSAGHSTASGQGDKKPYECTLCNKTFTAKQNYVKHMFVH
TGEKPHQCSICWRSFSLKDYLIKHMVTHTGVRAYQCSICNKRFTQKSSLNVHMRLHRGEK
SYECYICKKKFSHKTLLERHVALHSASNGTPPAGTPPGARAGPPGVVACTEGTTYVCSVC
PAKFDQIEQFNDHMRMHVSDG
NT seq 2226 nt   +upstreamnt  +downstreamnt
atgctagaacggaagaaacccaagacagctgaaaaccagaaggcatctgaggagaatgag
attactcagccgggcggatccagcgccaagccggcccttccctgcctgaactttgaagct
gttttgtctccagccccagccctcatccactcgacacattcactgacaaactctcacgct
cacaccgggtcatctgattgtgacatcagttgcaaggggatgaccgagcgcattcacagc
atcaaccttcacaacttcagcaattccgtgctcgagaccctcaacgagcagcgcaaccgt
ggccacttctgtgacgtgacggttcgcatccacgggagcatgctgcgcgcacatcgctgc
gtgctggcagccggcagccccttcttccaagacaagctgctgctgggctacagcgacatc
gaaatcccgtcggtggtgtccgtacaatcggtgcaaaagctcattgacttcatgtacagc
ggtgtgctgagagtctcacagtcggaagctctgcagatcctcacagccgccagcatcctg
cagatcaaaacagtcatagatgagtgcactcgcatcgtgtcacagaacgtgggcgatgtg
ttcccaggcatccaggattctggccaggacacaccaagaggcacaccagagtcaggcaca
tctggccagagcagtgacacggaatcaggctacctgcagagccacccacagcatagtgtg
gaccgaatctactccgcactctacgcctgctccatgcagaatggcagcggcgagcgctcc
ttctacagtggtgcagtggtcagccaccacgaaacagctctcggcctgccccgtgaccac
cacatggaagaccctagctggatcacacgcattcatgagcgctcccagcaaatggagcgc
tacctgtccaccacccctgagaccacgcactgccggaagcagccccggcctgtgcgtatc
cagaccctggtgggtaacatccacatcaagcaggaaatggaagatgactatgactactat
gggcagcaaagggtgcagatcctagaacgcaatgaatccgaggagtgcacagaagacact
gaccaagcagagggcactgagagcgagcccaaaggtgaaagctttgattctggggtcagc
tcctccatcggcaccgaacctgactcagtggagcaacagtttggggcagcagccccaagg
gacggtcaggcagaacccgcccaacctgagcaggcagcagaagccccagctgagagcagt
gcccagccaaaccagctagaaccaggtgcctcctctcctgagagaagcaacgagtcagag
atggacaacacagtcatcactgtcagtaacagctccgataagggcgtcctacagcagcct
tcagtcaacacatccatcgggcagccattgccaagtacccagctctatttacgccagaca
gaaaccctcaccagcaacctgaggatgcctctgaccttgaccagcaacacacaggtcatt
ggcaccgctggcaacacctatctgccagccctcttcactacccaacccgcgggcagtggc
cccaagccttttctcttcagcctgccgcagcccctgacaggccagcagacccagtttgtg
acagtgtcccagcccggtctgtccacctttactgcacagctgccagcgccacagcccctg
gcctcatctgcaggccacagcacagccagtgggcaaggcgacaaaaagccttatgagtgc
actctctgcaacaagactttcacagccaaacagaactacgtcaagcacatgttcgtacat
acaggtgagaagccccaccagtgcagcatctgctggcgctccttctccttgaaggattac
cttatcaagcacatggtgacgcacaccggcgtgagagcgtaccagtgtagcatctgcaac
aagcgcttcacccagaagagttccctcaacgtgcacatgcgcctgcaccgcggggagaag
tcctatgagtgctacatctgcaaaaagaagttctcccacaagaccctgctggagcgacac
gtggccctgcacagtgccagcaacgggacccctccggcaggcacgcccccaggtgcccgc
gcgggtccgccaggcgtggtggcctgcacagaggggaccacttacgtctgctccgtctgc
ccagcaaagtttgaccaaatcgagcagttcaacgaccacatgaggatgcatgtgtctgac
ggataa

DBGET integrated database retrieval system