KEGG   Mus musculus (mouse): 56496
Entry
56496             CDS       T01002                                 

Symbol
Tspan6, 6720473L21Rik, AI316786, T245, TSPAN-6, Tm4sf, Tm4sf6
Name
(RefSeq) tetraspanin 6
  KO
K17295  tetraspanin-6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    56496 (Tspan6)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   56496 (Tspan6)
SSDB
Motif
Pfam: Tetraspanin 4HB_MCP_1 DUF4190 Phage_holin_3_6
Other DBs
NCBI-GeneID: 56496
NCBI-ProteinID: NP_062630
MGI: 1926264
Ensembl: ENSMUSG00000067377
Vega: OTTMUSG00000018712
UniProt: Q99L96
Position
X; X E3
AA seq 245 aa
MASPSRRLQTKPVITCLKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNV
PFVLIGTGTVIILLGTFGCFATCRASAWMLKLYAMFLTLIFLVELVAAIVGFVFRHEIKN
SFKSNYENALKEYNSTGDYRSEAVDKIQSTLHCCGVTNYGDWKGTNYYSETGFPKSCCKL
EGCYPQRDADKVNEEGCFIKVMTTIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNN
QYEIV
NT seq 738 nt   +upstreamnt  +downstreamnt
atggcgtccccatctcggaggctgcagactaagccggtcattacttgtttgaaaagcgtt
ctcttgatctacactttcatcttttggatcactggtgttatccttcttgccgttggcatt
tggggcaaggtgagcctggaaaattatttttccctcttaaatgagaaggccaccaatgtg
ccttttgtgctcattggcacaggcactgtcattattctcttgggcacctttggttgtttc
gctacctgtcgagcctccgcctggatgctgaaactgtacgcgatgtttctgacactcatt
tttttggtcgaactagttgccgccattgttggatttgttttcagacatgagattaagaac
agctttaaaagtaactatgaaaacgctctgaaggagtacaactccacaggagactataga
agtgaagctgtagacaagatccaaagtacgttgcattgttgcggtgtcaccaattacgga
gattggaaaggtacgaactattactcagaaacaggatttcccaagagctgctgtaaactg
gagggctgttatccacagagagatgcagataaagtcaacgaagagggttgtttcataaag
gtaatgacaactatagagtcagaaatgggagtcgttgctggaatttcttttggagttgct
tgctttcagctaattggaatctttcttgcctactgcctgtctcgtgccataacgaataac
cagtatgagatagtataa

DBGET integrated database retrieval system