KEGG   Mus musculus (mouse): 56513Help
Entry
56513             CDS       T01002                                 

Gene name
Pard6a, 0710008C04Rik, 2610010A15Rik, PAR-6A, PAR6alpha, Par-6, Par6, Par6c, TAX40, Tip-40
Definition
(RefSeq) par-6 family cell polarity regulator alpha
  KO
K06093  partitioning defective protein 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04144  Endocytosis
mmu04360  Axon guidance
mmu04390  Hippo signaling pathway
mmu04530  Tight junction
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    56513 (Pard6a)
   04390 Hippo signaling pathway
    56513 (Pard6a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    56513 (Pard6a)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    56513 (Pard6a)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    56513 (Pard6a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    56513 (Pard6a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    56513 (Pard6a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     56513 (Pard6a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PB1 PDZ PDZ_6
Motif
Other DBs
NCBI-GeneID: 56513
NCBI-ProteinID: NP_062669
MGI: 1927223
Ensembl: ENSMUSG00000005699
Vega: OTTMUSG00000062054
UniProt: Q9Z101 Q3TY70
Position
8; 8 D3
AA seq 346 aa AA seqDB search
MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRTSVRGFQEFSRLLCVVHQIPGLDVLLG
YTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKRAEGDSSGLAFASNSLQRRKKGLLLR
PVAPLRTRPPLLISLPQDFRQVSSVIDVDLLPETHRRVRLHKHGSDRPLGFYIRDGMSVR
VAPQGLERVPGIFISRLVRGGLAESTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSH
NLIVTVKPANQRNNVVRGASGRLTGPSSVGPGPTDPDSDDDSSDLVIENRHPPCSNGLSQ
GPLCWDLQPGCLLPGAGSSLPSLDSREQANSGWGNGMRGDVSGFSL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggccaggccgcagaggactccggcgcgcagtcccgatagcatcgtcgaggtgaagagc
aaatttgacgccgagttccgacgctttgcactaccccgcacttcggtgagaggctttcag
gagttctcgcgattgctgtgtgtggtacaccagatccctggcctggacgtcctgcttggc
tatacggatgctcacggtgacttgctgcccctcaccaacgatgacagtttgcaccgggcc
ctggccagcgggcccccacctctgcgcctcttggttcagaaacgggcagaaggtgactcg
agtggcctggcttttgcctccaactctctacaaaggcgcaagaaagggctcctgctacga
ccagtggcacctctgcgcaccaggccacccttgttaatcagcttgccccaagatttccgc
caggtgtcttcagttatagatgtggacctactacctgagacccaccgacgagtgaggctg
cacaaacatggttcagaccgtcccctgggcttctacattcgagatggcatgagtgttcgc
gtggctccccagggcctggagcgggttccaggtatcttcatctcccgcctggtacgtggg
ggcctggctgagagtacagggctgctggcggtcagtgatgagatccttgaggtcaacggc
attgaggtggccgggaagaccttggaccaagtgacggacatgatggtcgccaacagccac
aacctcatcgtcactgtcaagcctgccaaccagcgtaataatgtggtacggggggcatct
gggcgtctgacagggccttcctctgtagggcctgggcctactgatcctgacagtgacgat
gacagcagtgacctggtcattgagaatcgccaccctccctgttctaatgggctgtctcag
gggcccctgtgctgggacctgcaacctggctgcctacttcctggtgctggcagctctctg
ccctccttggatagcagagagcaagccaattctggctgggggaatggcatgcgaggtgat
gttagcggattcagcctctga

DBGET integrated database retrieval system