KEGG   Mus musculus (house mouse): 56531
Entry
56531             CDS       T01002                                 
Symbol
Ylpm1, A930013E17Rik, ZAP, Zap3
Name
(RefSeq) YLP motif containing 1
  KO
K17602  YLP motif-containing protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    56531 (Ylpm1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     56531 (Ylpm1)
SSDB
Motif
Pfam: AAA_33 6PF2K KTI12 Zeta_toxin AAA_18 AAA_17 KAP_NTPase
Other DBs
NCBI-GeneID: 56531
NCBI-ProteinID: NP_001334350
MGI: 1926195
Ensembl: ENSMUSG00000021244
UniProt: E9Q803 Q8C8U8
Position
12:85042977..85130501
AA seq 1433 aa
MYPNWGRYGGSSHYPPPPVPPPPPPVALPEASPGPGYSSSTAPAAPSSSGFMSFREQHLA
QLQQLQQMHQKQMQCVLQPHHLPPPPLPPPPVMPGGGYGDWQPPPPPMPPPPGPALSYQK
QQQYKHQMIHHQRDGPPGLVPMELESPPESPPVPPGSYMPPSQSYMPPPQPPPSYYPPSS
AQPYLPPAQPSPSQSPPSQSYLAPTPSYSSSSSSQSYLSHSQPYLPPSQASPSRSSQGPS
KPQLPPPPSIPSGNKTAIQQEPLESGAKNKTAEQKQAAPEPDPSTMTPQEQQQYWYRQHL
LSLQQRTKVHLPGHKKGLVTAKDVPEPIKEEAPGPAASQVAEPLAAEKPPLPPPNEEAPP
PLSPEEPQSEDSEDSEDSEEDARFKQLKAIAAHWQAAAAHWQQQQQQRVGFQYQGIMQRH
TQLQQILQQYQQVIQHSPHIQTMSLDVQLRHYEMQQQQFQHLFQDWEREFQLWEEQLHSY
PHKDQLQEYEKQWKTWQGHMKATQTYLQEKVNSFQTVKSQYLGNMAMPPPFVPYSQMPPP
LPTMPPPVLPPSLPPPVMPPALPTSIPPPGMPPPVMPPSLPTSVPPPGMPPSLSSGPPPV
LPPPALSSAGSPPVLPPPALPGGPPILPLPPLSSATPPPGIPPPGAPQGMPPQLTAPLPP
ASGSQNSQIPEKPRQALLPTPVSFGSTPPSPYHPPPQSEQVNSKPLNKVFSSEQGLGESS
ALSQSIIAAKDTPVKSGGLLADPPKGSFLEGPRGPREQKEQLQKLKDFGSEPQMADHLPP
PDSRLQNPSRPGMYPPPGSYRPPPPMGKPPGSIVRPSAPPARSSIPMTRPPVPIPPPPPP
PPPPPPPPPVIKSKTSSVKQERWDEDSFFGLWDTNDDQGLNSEFKRDTATIPSAPVLPPP
PVHSSIPPPGPMPMGMPPMSKPPPVQHTVDYGHGRDMPTNKVEQIPYGERITLRPDPLPE
RSTFDADHAGQRDRYDRDRDREPYFDRPSNITDHRDFKRDRETHRDRDRDRVLDYERDRF
DRERRPRDDRNQSYRDKKDHSSSRRGGFDRPSYDRKSDRPPYEGPPMFGGERRTYPEERM
PLPAPALGHQPPPVPRVEKKPESKNVDDILKPPGRESRPERIVVIMRGLPGSGKTHVAKL
IRDKEVEFGGPAPRVLSLDDYFIAEVEKEEKDPDSGKKVKKKVMEYEYEADMEETYRTSM
FKTFKKTLDDGFFPFIILDAINDRVRHFDQFWSAAKTKGFEVYLAEMSADNQTCGKRNIH
GRKLKEINKMAEHWEVAPRHMMRLDIRSLLQDAAIEEVEMEDFDANIEDQKEEKKDAEEE
ESELGYIPKSKWEMDTSEAKLDKLDGLRTGTKRKRDWEAIASRMEDYLQLPDDYETRASE
PGKKRVRWADLEEKKDADRKRAIGFVVGQTDWEKITDESGHLAERALNRTKYI
NT seq 4302 nt   +upstreamnt  +downstreamnt
atgtatccgaattggggccggtatggcgggagcagccactatccgccgccgccggtgccg
ccgccgccgccaccggtggcgcttcccgaggcctcgccggggcccgggtactccagttcg
acggctcccgcggccccttcctcttcaggcttcatgagcttccgagagcaacacttggcg
cagctccagcagctgcagcagatgcaccagaagcaaatgcagtgcgtgctccaaccccac
catcttcctccgcccccgctgccacccccgccggtgatgcccgggggcggctacggagac
tggcagccgcctccgccaccgatgcccccgccacctggaccagccctcagttatcagaag
cagcagcagtacaaacaccagatgatccaccaccaacgagatgggcctccgggtttggtt
ccaatggagctggagtcccctcctgaatctccccctgtacctccaggatcctacatgccc
ccatcccagtcgtacatgcctccacctcagccaccaccctcgtactatcccccttcctcc
gctcagccctacctgcctcctgctcagccatccccttcacagtctccaccttcccagtcc
tatctggcgcccactccttcttattcttcctcgtcctcctcacaatcatatttgagccat
tcccagccctacttacccccttctcaggcctctccttcccgctcctcccagggcccttct
aaaccccagctaccaccaccaccgtccatcccttctgggaataaaacagctatccagcaa
gagcctttggagagtggggccaagaacaagactgctgaacagaagcaagctgctcctgaa
ccagatccctctacaatgactccacaggagcaacaacaatattggtatcgacagcatcta
cttagtttgcagcagaggacaaaggtgcatttgccgggacataaaaagggtcttgtcaca
gcaaaggatgtaccagaacccatcaaagaagaagctccggggccagctgccagtcaggta
gcagaacctcttgcagctgagaagcccccattgccacctcccaatgaagaagcaccacct
ccgctctcacctgaggaaccccagtcagaagactcagaagactcggaagactctgaggag
gatgctagatttaaacagttgaaggctatagcagcacattggcaggctgcagcagcacat
tggcaacagcagcagcagcagcgagtcggcttccagtatcaaggaataatgcagaggcac
acacagttacagcagatcctgcagcagtaccagcaagttatccagcactcaccacacata
cagaccatgtctctggatgtgcagctgcgacattatgagatgcagcagcaacagtttcaa
catctctttcaagactgggagcgagagtttcagctgtgggaggagcagctccattcctat
cctcataaagatcagcttcaggagtatgagaagcagtggaagacatggcagggacatatg
aaagccactcagacctatctccaggagaaagtcaactcgttccagactgtgaagagccag
tacctggggaacatggcaatgccacctccgtttgttccgtattctcagatgcctccacct
ctgccaacaatgccacctccagtattacctccatccttgccaccaccagtgatgccccct
gccctgcctacctccatcccaccacctggcatgcctccgcctgtgatgccaccttctctg
ccaacctctgtccccccaccaggaatgcctccatctctttcttcagggccacctccagtt
ctccctccacctgccctctcttcagcagggtcaccaccagtccttcccccaccggctcta
cctgggggaccacccatcctacccctcccaccattatcttcagccacacctcccccagga
atacctccccctggagctccacaagggatgcctcctcagttaacagccccacttccacca
gcttctggttctcagaactcacagatcccagagaaacctagacaagcactgcttcccaca
cctgtgtcttttggatcgaccccaccttcaccatatcaccctccacctcagtcagaacaa
gtgaattccaaacctctgaacaaggtgttctcatctgagcaaggactgggcgagtcttct
gctctatctcagtccatcattgcagctaaggacacgccagtgaagtcaggtggactgctt
gcagaccctcctaagggcagtttcttggaaggtccgagaggtccaagagaacagaaagag
cagcttcaaaagttgaaagactttgggtctgagccacagatggctgaccatctaccaccc
ccagactcaagactacagaatccatcaagacctgggatgtatccgcctccaggatcctat
agaccaccccctcctatgggtaagccacctgggtcaattgtaagaccctctgctccacca
gcaagatcatctattcctatgactaggcctcctgtgccaataccaccaccgcctcctcca
cctccaccaccaccacctcctcctccagttataaagtcaaaaacctcatctgtgaaacag
gaacgctgggatgaagattctttctttgggctctgggatacaaatgatgatcaaggactg
aattcagaatttaagcgagacactgcaacaattccgtctgctccggtgttaccaccccca
cctgttcattcttccattccccctcctggcccaatgcctatgggtatgccaccaatgtcc
aaaccaccaccagtgcagcatacagttgactatggccatggccgagatatgcctactaat
aaagttgaacagataccatatggagaaagaataactctacgtccagatccattacctgaa
aggtcaacttttgatgcagatcatgcaggccagcgtgatcgctatgatagagatagagac
cgtgaaccttattttgaccgtccaagtaatataacagatcatcgagattttaaaagggac
cgagagacacatagagatagagaccgagatcgtgttcttgactatgagcgggaccgattt
gacagagagcgcagaccccgagatgacaggaatcaatcatatcgagacaaaaaagaccat
tcttcatccagaagaggagggtttgacaggccatcctatgaccggaagtctgatagacca
ccctatgaaggcccacccatgtttggaggagaacgaagaacttacccagaggagcgcatg
ccccttccagctcctgccctgggccaccagccacctccagttcctcgggttgagaagaag
ccggagtccaaaaatgtggatgacattctgaaaccgccgggccgggagagccggcctgaa
agaattgttgttataatgagaggattgcctggcagtggaaagacacatgttgcaaaactt
atccgggataaggaagtagaatttggaggacctgcccccagggttttaagtctagatgat
tatttcatcgctgaagtagaaaaagaagaaaaagatccagattctggaaagaaagtaaaa
aagaaggtaatggaatatgaatatgaagctgacatggaagagacttatcgcaccagcatg
ttcaaaactttcaaaaagactctagatgacggctttttccctttcattattctggatgct
atcaatgacagagttagacattttgatcagttttggagtgcagcgaaaaccaagggtttt
gaggtgtatttggctgaaatgagtgctgataaccagacttgtggcaagagaaatattcat
ggaagaaagcttaaagaaataaacaagatggctgaacactgggaagttgcacctcgtcac
atgatgcgtctagacatccgctccctgctacaagatgctgcgattgaagaagtagagatg
gaagattttgatgctaacattgaagaccagaaggaagaaaagaaagatgcagaagaagag
gaaagcgaactgggttacattccgaaaagcaaatgggagatggacacttctgaggcaaag
ctagacaagttggatggcttgaggactggtactaaaaggaagcgagactgggaggcgatt
gccagcagaatggaggattaccttcagctccctgacgactacgagactcgcgcttctgag
cctgggaagaagagggtgagatgggcagacctagaagaaaagaaggatgcagataggaaa
agggccataggttttgtggtcggacagactgattgggagaagatcacagatgagagtggt
cacctggctgaaagagccctcaatcggaccaaatatatatga

DBGET integrated database retrieval system