KEGG   Mus musculus (mouse): 56535
Entry
56535             CDS       T01002                                 

Gene name
Pex3, 1700014F15Rik, 2810027F19Rik, 2900010N04Rik
Definition
(RefSeq) peroxisomal biogenesis factor 3
  KO
K13336  peroxin-3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    56535 (Pex3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    56535 (Pex3)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Pexophagy
   Selective cargos
    56535 (Pex3)
SSDB
Motif
Pfam: Peroxin-3
Other DBs
NCBI-GeneID: 56535
NCBI-ProteinID: NP_064345
MGI: 1929646
Ensembl: ENSMUSG00000019809
Vega: OTTMUSG00000020905
UniProt: Q9QXY9 Q3UIG2
Position
10; 10 A2
AA seq 372 aa
MLRSMWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAAEYIAQARRQYHFES
NQRTCNMTVLSMLPTLREALMQQLNSESLTALLKSRPSNKLEIWEDLKIISFTRSIVAVY
STCMLVVLLRVQLNIIGGYIYLDNATVGKNGTTVLAPPDVQQQYLSSIQHLLGDGLTELV
TVIKQAVQRILGSVSLKHSLSLLDLEQKLKEIRILVEQHQSSWNDKDVSRSSLCQYMMPD
EETPLAAQAYGLSHRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRP
TEQDLQHGNSINSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLMMEQVKDFAANV
YEAFSTPQQLEK
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgctgagatcaatgtggaattttctgaaacgtcacaaaaagaaatgcatcttcctgggc
acagtcctcggaggagtatatatcctgggaaaatatggacagaaaaaaattagagaaata
caagaaagagaagctgcagaatacattgcccaagctcggcgacagtaccattttgaaagc
aaccagaggacttgcaatatgacagtgctgtccatgctgccgacactgagagaggcctta
atgcagcagctcaactcggagagtctcacagctctgttgaaaagcaggccttcaaacaag
ctggaaatatgggaggacctaaagataataagtttcacaagaagtattgtagctgtatat
agcacgtgtatgctggtggttcttttgcgagtccagttaaacataattggtggatatatt
tacctggataatgcaacagttggcaaaaatggcactaccgttcttgctcctccggatgta
cagcagcagtatttatcaagtattcaacacctccttggagacggcctcacagagttggtc
actgtcattaaacaagctgtacaaaggatcttaggaagtgtctctcttaaacattccttg
tcccttttggacttggagcaaaaactaaaagaaatcagaattcttgttgagcaacatcag
tcttcttggaatgataaagatgtgtccaggtcttcactgtgccagtacatgatgccagat
gaggagacaccattggcagctcaggcctatgggctttctcacagagatatcaccactatt
aaacttctcaatgagacaagagacatgctggaaagtccagattttagtacagttttgaat
acctgtctaaacagaggcttcagtcggcttctagacaacatggccgaattctttcgaccc
actgagcaggacctacagcatggtaactccataaacagtctgtccagtgtcagcctgcct
ttagctaagataattcccatagtgaacgggcagatccattcagtttgcagtgagacacct
agtcattttgtgcaggatctgctgatgatggaacaggtgaaagactttgctgctaacgtg
tacgaagcgtttagtaccccccaacaactggagaaatga

DBGET integrated database retrieval system